KEGG   Novosphingobium sp. P6W: TQ38_013835Help
Entry
TQ38_013835       CDS       T05550                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov00473  D-Alanine metabolism
nov00550  Peptidoglycan biosynthesis
nov01100  Metabolic pathways
nov01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TQ38_013835
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TQ38_013835
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TQ38_013835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nov01011]
    TQ38_013835
Enzymes [BR:nov01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TQ38_013835
Peptidoglycan biosynthesis and degradation proteins [BR:nov01011]
 Precursor biosynthesis
  Amino acid ligase
   TQ38_013835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AXB77443
UniProt: A0A2Z5ECH2
LinkDB All DBs
Position
1:complement(2878542..2879495)
Genome map
AA seq 317 aa AA seqDB search
MSLPTLHVAVLMGGWSSERPVSLMSGEGVAKALEGKGHKVTRIDMDRDVALRLAEAKPDV
VFNALHGTPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKELTKQALVPHGIPMPGGRVV
KCAEIHERDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIARDVTGPWQEFDELLAEPY
IRGRELTTAVIGDRALLVTELRPKSGFYDFDSKYTDGLTEHICPAEIPDEIAQACKDFAL
RSHQLLGCKGTSRADFRWDDTQGIEGLFLLEVNTQPGMTPLSLVPEQARACGMEYPELVE
AIIAEALGDAKPKAGAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcccacactccatgtcgcagtcctgatgggcggttggtcgagcgaacgcccg
gtctcgctgatgagcggcgagggcgtggccaaggcgcttgagggcaagggccacaaggtg
acccgcatcgacatggaccgcgatgtcgcgctgcgcctcgccgaggcaaagccggacgtg
gtgttcaatgcgctgcacggcacgccgggcgaagacggcacggtgcagggcatgatggac
ctgatgggcctcacctatacccactccggcctcgcgacgtcggtgatcgccatcgacaag
gaactgaccaagcaggcgctggtcccgcacggcatccccatgcccggcgggcgcgtggtc
aagtgcgccgaaatccatgagcgcgatccgctgccacgcccttatgttctcaagccggtc
aacgaggggtcgtcggtgggcgtcgccatcgtcacggccgaggggaactacggcaacccg
atcgcgcgtgacgtcacgggtccgtggcaggaattcgacgaactgctggccgagccttac
atccggggccgcgaactgacgactgccgtgatcggtgatcgcgctctgctggtgaccgaa
ctaaggcccaagtcgggcttctacgacttcgattccaagtacaccgacggccttaccgaa
cacatctgcccggccgaaatccccgacgagatcgcccaggcctgcaaggatttcgccctg
cgctcgcaccagctcttgggctgcaagggcaccagccgcgccgatttccgctgggatgac
acgcagggtatcgagggcctgttcctgctggaggtcaacacccagccgggcatgaccccc
ctcagcctcgttcccgagcaggcgcgcgcctgcggcatggaataccccgaactggtcgag
gcgatcatcgccgaggcgctcggcgacgcgaagccgaaagcaggcgcaaaatga

DBGET integrated database retrieval system