KEGG   Novosphingobium sp. P6W: TQ38_016525Help
Entry
TQ38_016525       CDS       T05550                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
nov  Novosphingobium sp. P6W
Brite
KEGG Orthology (KO) [BR:nov00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nov02000]
    TQ38_016525
Transporters [BR:nov02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    TQ38_016525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_23 SbcCD_C AAA_30 AAA_22 AAA_24
Motif
Other DBs
NCBI-ProteinID: AXB78289
UniProt: A0A2Z5EF74
LinkDB All DBs
Position
1:complement(3435112..3436062)
Genome map
AA seq 316 aa AA seqDB search
MPFDRPLAIEARGLVKRFEGFTAVDGVDLSVPAGSVYGILGPNGAGKTTTLRMLLGIIDP
DSGYRRILGSDRPHDVAHAIGYLPEERGLYPSMKATEAIAFLGALRGLPLKEGRRRAHEL
LERHGLGYAADRQIRQLSKGMAQQVQILGTLVHRPRLVIFDEPFSGLDALNQGKLEAMMR
GLAQDGATVIFSTHVIAHAERLCDEVAIIAGGKVPFAGPVDLARDRIPAQVRLETRALQG
AWRAALPADVRQDGQFWHFALPDSGIEPLLRALIAGEAGILSLSIERAGLHDAFVAIAGE
AAARALEEEKPEEPRR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ctgccctttgaccggccgctggcgatcgaagcacgcgggctggtcaagcgtttcgagggt
ttcaccgccgtcgacggcgtcgatctttcggtcccggcgggctccgtctacggcatcctt
ggccccaacggcgccggcaagaccaccactttacggatgcttctgggcatcatcgatccc
gattcgggctatcgccgcatccttggctccgatcgcccgcacgacgttgcccatgcgatc
ggctacctgcccgaggagcgcggcctctacccctcgatgaaggcgaccgaggcgatcgcg
tttctgggtgccctgcgcggactgccgctgaaggaaggccgccgccgcgcgcatgaactg
cttgaacggcacggccttggctatgccgccgaccgccagatccgccagctttccaagggc
atggcgcagcaggtccagattctgggcacgctggtccaccggccccggctggtgatcttc
gacgagccgttttccggcctcgatgctctcaaccagggcaagctggaagcgatgatgcgc
ggtctggcgcaggacggcgccaccgtgatcttctccacccacgtcatcgcccatgccgag
cggctgtgcgacgaagtggcgatcatcgccggcggcaaggtgcctttcgccggtccggtc
gacctggcgcgcgaccgcattccggcgcaggtccgtctcgagacccgcgcgctgcaaggc
gcgtggcgcgcggcgctgcctgccgatgtacggcaggacggccagttctggcacttcgcg
ctgcccgattcggggatcgaacccctgcttcgcgccctgatcgcgggagaggcgggcatc
ctttcgctttccatcgagcgggcgggcctgcacgatgccttcgtcgccatcgccggagaa
gccgccgcgcgcgccctggaagaggaaaagcccgaggagccgcgccgatga

DBGET integrated database retrieval system