KEGG   Novosphingobium sp. P6W: TQ38_018515Help
Entry
TQ38_018515       CDS       T05550                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
nov  Novosphingobium sp. P6W
Brite
KEGG Orthology (KO) [BR:nov00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    TQ38_018515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AXB78614
UniProt: A0A2Z5EG59
LinkDB All DBs
Position
2:475523..476248
Genome map
AA seq 241 aa AA seqDB search
MLALVFFLVAVLFAAVGQAGATGYLAALGWAGYGPDCIRPVALSLNIIVAAVGTFQFARA
KKLSLRTFYPFGVLGFPFSIAGGLLTLPHAIYFPIVGGLLLLAAVQLARLAIQGHQTLDQ
ELPPPFLWALLTGAGVGFVSGLTGTGGGIFLAPILYLTGWVGSSRASGVTAAYNLLNSAA
ALAAVLATAPGFPTAMPIWLLAVAAGGGIGSTLGARFLPERALRALLAVVLLVSAVRFLL
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgctggtcttttttctcgttgccgtattgttcgctgcggtcggacaagctggc
gcgacgggatatctcgctgcgctggggtgggcgggatatggacctgactgcatccgcccc
gtcgcgctctctctgaatataattgtagcagcggttggcacgtttcagttcgctcgtgcc
aaaaagctgtcgttgcgcaccttctatcccttcggcgtgctgggcttcccgttctctatc
gcaggcggcctgttgactctcccgcacgcgatttacttcccgattgtcgggggcctcctt
ctgctagccgcagtgcagttggcgcggttggcgatccagggtcaccagactttggatcag
gagctgcccccgccatttctatgggcattactgaccggcgccggagttggttttgtctca
ggattgaccggcacgggaggaggcatctttctcgctccgattctctacctcaccggatgg
gtaggtagttcgcgcgcgtccggtgtcaccgccgcatacaatctgctcaactctgcggcc
gcgctggcagccgtccttgcgaccgcgcccggattcccgacagccatgccgatatggttg
ctcgccgtcgccgcaggcggcggcatcggatcgacattgggcgcgcgatttcttcctgaa
agagcgctgagggcgctgttggccgttgtgctattggtgtcggcggtccggtttctattg
ggttag

DBGET integrated database retrieval system