KEGG   Nocardioides sp. MMS17-SY117: EXE57_00865Help
Entry
EXE57_00865       CDS       T05931                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase AcnA
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
noy  Nocardioides sp. MMS17-SY117
Pathway
noy00020  Citrate cycle (TCA cycle)
noy00630  Glyoxylate and dicarboxylate metabolism
noy01100  Metabolic pathways
noy01110  Biosynthesis of secondary metabolites
noy01120  Microbial metabolism in diverse environments
noy01130  Biosynthesis of antibiotics
noy01200  Carbon metabolism
noy01210  2-Oxocarboxylic acid metabolism
noy01230  Biosynthesis of amino acids
Module
noy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:noy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EXE57_00865 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    EXE57_00865 (acnA)
Enzymes [BR:noy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     EXE57_00865 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: QBR90979
UniProt: A0A4P7GH48
LinkDB All DBs
Position
189847..192528
Genome map
AA seq 893 aa AA seqDB search
MASQDSFGAKSTLSVGDQDYEIFRLDAVEGDGLDVKSLPFSLKVLLENLLRTEDGADITA
EDIKALAGWDADADPDKEIQFTPARVIMQDFTGVPCVVDLATMREAMADLGGDASKINPL
APAEMVIDHSVIADVFGSADAFERNVEIEYERNRERYQFLRWGQGAFDDFKVVPPGTGIV
HQVNIEHLARTVFTREVDGVLQAYPDTCVGTDSHTTMVNGIGVVGWGVGGIEAEAAMLGQ
PVSMLIPRVVGFKLSGELPEGSTATDLVLTITEMLRKHGVVGKFVEFYGDGVGALPLANR
ATIGNMSPEFGSTIAVFPIDEETIKYLELTGRPQEQLDLVEAYAREQGLWHDTDAEGYVE
PRYSEQLELDLATVVPSLAGPKRPQDRVEVTKAAAEFDKALADYTDDKAATATLSLDGQE
LEIGHGAVTIAAITSCTNTSNPSVMIGAALLAKNAVDKGLTRKPWVKTTLAPGSKVVSDY
YERAGLTPYLDKLGFNLVGYGCTTCIGNSGPLIPEVSQAVNDADLAVTSVLSGNRNFEGR
INPDVKMNYLASPPLVVAYALAGSMTVDLFNDPLGQDHDGNDVFLKDLWPSPAEIERVIG
EAINSDMFGSSYEDVFAGDERWRSLSTPEGDTFAWDPDSTYVRKAPYFDGMPDQPEPVAD
ISGARVLLKLGDSVTTDHISPAGAIKKDSPAGRYLQEHGVEQRDFNSYGSRRGNHEIMIR
GTFANIRLRNQLAPGTEGGVTRDFTRDGEETTVFEASERYIDAGIPLVVLAGKEYGSGSS
RDWAAKGTALLGVKAVIAESYERIHRSNLIGMGVLPLQFPEGETAESLGLTGEEEFSFTG
VTELNEGRTPRTVKVTAGDVEFDAVVRIDTPGEANYYRNGGIMPYVLRNLLRG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcaggacagcttcggcgccaagagcacgctcagcgtgggcgaccaggactac
gagatcttccggctcgacgccgtcgagggagacgggctcgacgtgaagagcctgcccttc
agcctcaaggtgctcctcgagaacctgctgcgcaccgaggacggtgccgacatcacggcc
gaggacatcaaggcgctcgccggctgggacgccgacgccgaccccgacaaggagatccag
ttcacgccggcccgcgtgatcatgcaggacttcaccggcgtgccctgcgtggtcgacctg
gccaccatgcgcgaggcgatggccgacctcggcggcgacgcgtcgaagatcaacccgctc
gccccggccgagatggtcatcgaccactccgtcatcgccgacgtcttcggctcggccgac
gccttcgagcgcaacgtcgagatcgagtacgagcgcaaccgtgagcgctaccagttcctc
cgctggggccagggcgccttcgacgacttcaaggtcgtcccgcccggcaccggcatcgtc
caccaggtcaacatcgagcacctcgcccgcaccgtgttcacccgtgaggtggacggggtg
ctccaggcgtaccccgacacctgcgtcggcaccgactcccacaccacgatggtcaacggc
atcggcgtcgtcggctggggcgtgggcggcatcgaggccgaggccgcgatgctcggccag
ccggtcagcatgctgatcccgcgggtcgtgggcttcaagctgtccggcgagctcccggag
ggctcgaccgcgaccgacctcgtgctgacgatcaccgagatgctgcgcaagcacggcgtg
gtcgggaagttcgtcgagttctacggtgacggcgtcggcgcgctcccgctcgccaaccgc
gccacgatcggcaacatgagtcccgagttcggctccaccatcgcggtcttcccgatcgac
gaggagaccatcaagtacctcgagctcaccggccggccgcaggagcagctcgacctggtc
gaggcgtacgccagggagcagggcctctggcacgacaccgacgccgagggctacgtcgag
ccccgctactccgagcagctggagctcgacctggcgacggtcgtgccgtcgctggccggc
cccaagcgcccgcaggaccgggtcgaggtcaccaaggcggcggcggagttcgacaaggcg
ctcgccgactacaccgacgacaaggccgcgaccgcgaccctgagcctggacggccaggag
ctcgagatcggccacggcgcggtcacgatcgcggcgatcacctcctgcaccaacacctcc
aacccgagcgtgatgatcggggcggcgctgctcgccaagaacgccgtcgacaagggcctc
acgcgcaagccgtgggtgaagaccacgctcgcgccgggctcgaaggtggtcagcgactac
tacgagcgcgccggcctgacgccgtacctcgacaagctcggcttcaacctcgtcggctac
ggctgcaccacctgcatcggcaactcgggcccgctcatccccgaggtcagccaggccgtc
aacgacgccgacctcgcggtcaccagcgtgctctccggcaaccgcaacttcgagggccgg
atcaacccggacgtgaagatgaactacctcgcgtcgccgccgctcgtggtcgcctacgcg
ctggcgggctcgatgacggtggacctgttcaacgacccgctgggccaggaccacgacggc
aacgacgtcttcctcaaggacctctggccctcgcctgccgagatcgagcgggtcatcggc
gaggcgatcaactccgacatgttcgggtcgtcctacgaggacgtcttcgccggtgacgag
cggtggcgctcgctgtccacccccgagggcgacaccttcgcctgggaccccgactcgacg
tacgtccgcaaggcgccctacttcgacggcatgcccgaccagcccgagccggtcgccgac
atctccggtgcgcgggtgctgctcaagctgggcgactcggtcaccaccgaccacatcagc
ccggccggcgccatcaagaaggacagccccgcgggtcgctacctgcaggagcacggggtc
gagcagcgggacttcaactcctacgggtcgcgccgcggcaaccacgagatcatgatccgc
ggcaccttcgccaacatccggctgcgcaaccagctggcccccggcaccgagggcggcgtc
acgcgcgacttcacgcgcgacggtgaggagacgacggtcttcgaggccagcgagcggtac
atcgacgccggcatcccgctggtcgtgctcgccggcaaggagtacggctcgggctcctcg
cgcgactgggccgcgaagggcacggcgctgctcggcgtcaaggcggtgatcgctgagtcc
tacgagcgcatccaccgctcgaacctgatcgggatgggcgtgctgccgctgcagttcccg
gagggcgagaccgcggagagcctgggcctcaccggcgaggaggagttctccttcaccggt
gtcaccgagctcaacgagggccggacgccgcgcaccgtgaaggtgaccgcgggtgacgtc
gagttcgacgccgtggtccggatcgacacccccggcgaggcgaactactaccgcaacggc
ggcatcatgccgtacgtcctgcgcaacctgctgcgcggctga

DBGET integrated database retrieval system