KEGG   Nocardioides sp. MMS17-SY117: EXE57_02995Help
Entry
EXE57_02995       CDS       T05931                                 

Definition
(GenBank) transporter substrate-binding domain-containing protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
noy  Nocardioides sp. MMS17-SY117
Brite
KEGG Orthology (KO) [BR:noy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:noy02000]
    EXE57_02995
Transporters [BR:noy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    EXE57_02995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd MVL YhfZ_C
Motif
Other DBs
NCBI-ProteinID: QBR91350
UniProt: A0A4P7GHI2
LinkDB All DBs
Position
complement(635216..636118)
Genome map
AA seq 300 aa AA seqDB search
MRTRFLLGTALTALLFPMLAACGGDSADDSGGDEPAASGEGVCAGETTDLLAEICEEGVL
TVSTDPAYPPQSRLNEQTGDYEGFDIDVATEIASRLGVEVAWETPAWDVITAGSWNGRWD
TTVGSMTPTNDRQEVLFFTEPYNYVPAVVVVGADNDDVSDISTDLDGAAIGVCTGCTYDQ
FLNKELDIEGYTFDFVIDDAEVSGYDTDTTALQDLANGRLDAVITSVTTAQGYIDEGNPV
KIVGEPVFNEPLAVGFDRSADPSSESLYEAVDGIVAEMHEDGTLSALAEEWYGLDTTKQE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacccgtttcctcctcggcaccgcgctcacggcgctcctcttcccgatgctggcc
gcctgtggcggcgacagcgccgacgactccggcggcgacgagcctgccgcgtcgggcgag
ggcgtgtgtgcgggcgagaccaccgacctcctcgccgagatctgcgaggagggggtgctc
acggtctccacggacccggcgtacccgccgcagtcccggctgaacgagcagacaggtgac
tacgagggcttcgacatcgacgtcgccaccgagatcgccagccggctcggcgtcgaggtc
gcgtgggagacccccgcgtgggacgtgatcaccgccggcagctggaacggtcgctgggac
acgacggtgggctcgatgacgcccaccaacgaccggcaggaggtgctcttcttcaccgag
ccctacaactacgtccctgccgtggtcgtggtcggggccgacaacgacgacgtctccgac
atcagcaccgacctcgacggcgcggccatcggggtctgcaccgggtgcacctacgaccag
ttcctcaacaaggagctcgacatcgagggctacaccttcgacttcgtcatcgacgacgcc
gaggtctccggctacgacaccgacaccaccgcgctgcaggacctcgccaacggtcggctc
gacgcggtgatcacctcggtcacgaccgcgcagggctacatcgacgaggggaaccccgtg
aagatcgtgggggagccggtcttcaacgaacccctcgcggtgggcttcgaccggagcgcc
gacccgtcctcggagagcctctacgaggcggtcgacgggatcgtcgccgagatgcacgag
gacggcaccctctccgccctggcggaggagtggtacggcctcgacaccaccaagcaggag
tga

DBGET integrated database retrieval system