KEGG   Nocardioides sp. MMS17-SY117: EXE57_04870Help
Entry
EXE57_04870       CDS       T05931                                 

Gene name
glgX
Definition
(GenBank) glycogen debranching protein GlgX
  KO
K01214  isoamylase [EC:3.2.1.68]
Organism
noy  Nocardioides sp. MMS17-SY117
Pathway
noy00500  Starch and sucrose metabolism
noy01100  Metabolic pathways
noy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EXE57_04870 (glgX)
Enzymes [BR:noy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     EXE57_04870 (glgX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase GHL5
Motif
Other DBs
NCBI-ProteinID: QBR91671
UniProt: A0A4P7GJ65
LinkDB All DBs
Position
1030495..1032642
Genome map
AA seq 715 aa AA seqDB search
MGRVSLNTWRWQHHDETTPLWPGFHQQLGATWAPEATNFAVWAPQATAAWVCVFDEEGTE
TSHRLTEHTLGVWHGKLPGVRVGQRYGFRTDGPWDPGHGLRFNPAKLLLDPYARAISGEV
APGDLALPHTGDGRSRDPRDSAPAVPRSVVVHDEFDWEGDTRLRTRWRDTVIYELHVKGF
TQLHDRVPEELRGTYAGLGSEAVTDYLNDLGVTAVELLPVQHFLTEPSVAERGMTNYWGY
NTIGYLAPHAAYSSTGDRGQQVTEFKQMVKNFHRAGIEVFLDVVYNHTAEGGPTGPSYSF
RGLDDAGFYKRSGTGDDAYWDVTGCGNTVDTTNPGALRLILDSLRYWVTEMHVDGFRFDL
ASALARTGHDIDMHGAFLTTIGQDPVLRYVKLIAEPWDASMDGYRVGSFPPPWVEWNDRY
RDTMRDFWRPGAGSVREAASRLAGSSDLYADDGRSPYASVNFVTAHDGFTLRDWTTYEHK
HNEANGEDNRDGTDGNRSYNFGHEGETDDPGVIALRRRIASNMIATLCLSNGSPMITAGD
ERGRTQRGNNNAYVQDNEVSWLDWRPDDAWLDVYEVTKAALRLRREHPALRQRHHFAGSP
TIEGGPKDLAWLHPEGREMSPLDWHDGTLEVIGMFVSGDPLRSPGPRGEQQRDASFMLWF
NSGEQPVEVALPDNAWVRTGEVVLSTDPDLPHGTAVLAGEPLTLGGLTVVVLRQT
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggtgagcctcaacacctggcggtggcagcaccacgacgagacgacgcccctc
tggccggggttccaccagcagctcggcgcgacgtgggcgcccgaggccaccaacttcgcg
gtctgggcgccgcaggcgaccgcggcctgggtctgcgtcttcgacgaggagggcaccgag
accagccaccggctgaccgagcacacgctcggggtctggcacggcaagctgccaggtgtc
cgggtcggccagcgctacggcttccgcaccgacggtccctgggaccccgggcacggcctg
cgcttcaacccggccaagctgctcctcgacccgtacgcccgcgcgatctcgggcgaggtc
gcgccgggcgacctcgcactcccccacaccggcgacgggcgctcccgcgacccccgcgac
tcggcgcccgcggtcccgcggtcggtggtcgtgcacgacgagttcgactgggagggcgac
acccggctccggacgcgctggcgcgacacggtcatctacgagctgcacgtcaagggcttc
acgcagctgcacgaccgggtgcccgaggagctgcgcgggacgtacgccggcctcggcagc
gaggccgtgaccgactatctcaacgacctgggcgtgaccgcggtggagctgctgccggtg
cagcacttcctgaccgagccctcggtcgccgagcgcgggatgaccaactactggggctac
aacacgatcggctacctcgcgccgcacgcggcgtactcctccacgggcgaccgcggtcag
caggtcaccgagttcaagcagatggtgaagaacttccaccgagccgggatcgaggtgttc
ctcgacgtggtctacaaccacaccgccgagggcggcccgaccgggccgtcgtactcgttc
cgggggctggacgacgccggcttctacaagcggtccggcaccggcgacgacgcctactgg
gacgtcacgggctgcggcaacaccgtcgacaccaccaaccccggcgcgctgcggctgatc
ctggactcgctgcgctactgggtcaccgagatgcacgtcgacgggttccggttcgacctc
gcctcggcactggcgcggaccggccacgacatcgacatgcacggcgcgttcctgacgacc
atcgggcaggaccccgtgctgcgctacgtgaagctgatcgcggagccgtgggacgcctcg
atggacggctaccgggtcggctccttcccgccgccgtgggtggagtggaacgaccgctac
cgcgacacgatgcgcgacttctggcggccgggcgcgggatcggtccgcgaggccgcctca
cggctggccgggagctcggacctctacgccgacgacgggcggtcgccgtacgcctcggtc
aacttcgtgacggcccacgacggcttcacgctgcgcgactggacgacctacgagcacaag
cacaacgaggccaacggcgaggacaaccgggacggcaccgacggcaaccggtcgtacaac
ttcggccacgagggcgagacggacgatccgggggtgatcgctctccggcgccggatcgcg
tcgaacatgatcgccacgctgtgcctgtccaacgggtcaccgatgatcaccgccggcgac
gagcgtggccgcacccagcgcggcaacaacaacgcctacgtccaggacaacgaggtgtcg
tggctcgactggcgccccgacgacgcctggctcgacgtgtacgaggtcaccaaggccgcg
ctgcggctgcggcgcgagcacccggcgctgcggcagcggcaccacttcgcaggctccccg
accatcgagggcgggccgaaggacctggcctggctgcaccccgaggggcgcgagatgtcg
ccgctggactggcacgacggcaccctcgaggtgatcgggatgttcgtctccggcgacccg
ctccgctcccccggcccgcgcggcgagcagcagcgggacgcctcgttcatgctgtggttc
aactccggcgagcagccggtcgaggtcgcgctccccgacaacgcgtgggtccggaccggc
gaggtggtcctctccaccgacccggacctcccccacggcaccgcggtcctcgccggcgag
ccgctcaccctcggcggcctcaccgtcgtggtgctccgccagacctga

DBGET integrated database retrieval system