KEGG   Nocardia sp. CS682: DMB37_09235Help
Entry
DMB37_09235       CDS       T06040                                 

Definition
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
noz  Nocardia sp. CS682
Brite
KEGG Orthology (KO) [BR:noz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:noz03016]
    DMB37_09235
Enzymes [BR:noz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     DMB37_09235
Transfer RNA biogenesis [BR:noz03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    DMB37_09235
 Prokaryotic type
    DMB37_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2
Motif
Other DBs
NCBI-ProteinID: QBS40272
UniProt: A0A4P7H0D2
LinkDB All DBs
Position
complement(2078751..2079656)
Genome map
AA seq 301 aa AA seqDB search
MNGLGGLLIVDKDGGWTSHDVVAKCRKLLRTKKIGHAGTLDPMATGVLVLGVERATKLLG
LLTLTTKAYTATVRLGQATTTDDAEGEVLSTTPALHLVDTDIAAHTAKLTGDIEQVPATV
SAIKVDGERAYARHRAGEDVQLAARPVTVSRFDILARRDIQDGAFVDLDVLVECSSGTYV
RALARDLGAALGVGGHLTALRRTRVGPFTLEHARTLDELATAAESQDSLLSLDMDEAVRT
AFPHREIDEAQANDLRNGRWLDPIGLPGVYAAIDQEGRAIALLQESGKRAASVMVVRPSN
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtctcggcggactgctgatcgtcgacaaggatggcggctggaccagccacgac
gtcgtcgcgaagtgccggaagctgctgcgcaccaagaagatcggccatgcgggcaccctc
gacccgatggcgaccggtgtgctggtgctcggtgtggaacgcgccaccaaactgctcggc
ctgctcacgctcaccaccaaggcgtacaccgcgaccgtccgcctcggtcaggccaccacc
accgacgacgccgagggggaagtgctgtcgaccaccccggccctgcacctcgtcgatacc
gacatcgccgcgcacacggcgaaactcaccggcgacatcgaacaggtgcccgccaccgtc
agcgcgatcaaagtggacggcgaacgcgcctacgcccggcaccgcgcaggcgaagacgtg
cagctggccgcccgcccggtcaccgtgtcccgcttcgacatcctcgcccgccgtgacatc
caggacggcgcgttcgtcgacctggacgtgctcgtcgaatgctcctccggcacctacgtg
cgcgccctggcccgcgacctcggtgccgcgctcggcgtcggcggccacctgacggctttg
cgccgcaccagagtcggcccgttcaccctcgaacacgcccgcaccctggacgaattggcc
accgccgccgaatcccaggactccctgctcagcctcgacatggacgaggcggtccgaacc
gccttcccgcaccgggagatcgacgaagcccaagccaacgacctccgcaacggccgctgg
ctggaccccatcggcctgcccggcgtctacgccgccatcgaccaggaggggcgcgcgatc
gccctgctccaggagagcggcaagcgcgcggcatccgtcatggtcgtccgcccgtcgaac
ctgtag

DBGET integrated database retrieval system