KEGG   Nocardia sp. CS682: DMB37_21205Help
Entry
DMB37_21205       CDS       T06040                                 

Definition
(GenBank) DUF2662 domain-containing protein
Organism
noz  Nocardia sp. CS682
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3662 FHA Yop-YscD_cpl DUF1737
Motif
Other DBs
NCBI-ProteinID: QBS42270
UniProt: A0A4P7H5F3
LinkDB All DBs
Position
complement(4671939..4673402)
Genome map
AA seq 487 aa AA seqDB search
MRVSLLRISRRDAHRREAGMGIVSRFERRLQGAVGDVFARVFGGNVVPQEVEAALQREAA
DHVQELDGGHLLAPNSYVITINSSDHQQLDADHDLTTRAFAKHLQDYIREQGWQTYGEVH
VAFEASPTLHTGQFRASGRVDPDVGRGATPAHSPERTPQRPANPQPGAGPMTQNSGYDPS
REPAESDPRNRGYAPPPAGRGGAQNGAYREDYGRGAAPYGADYPAPEGQQGYGDYQNGYD
YQQGGQAYGQPGYQEPGYAAQQPGYADRGYGQPGYQEPAYGQPGYQEPPAYGQPGYQEPG
YGQQGYAQQGYGDQAYADPAYGQQGAGYAQPGYGQQGYQEPGYGEQAYAEPGAYGQDDQG
GYGQAYSQQPGYGAQPGYGAAPAYAAPPQAGSGYSATLQLDDGSGRTYQLREGSNIIGRG
QDAHFRLPDTGVSRRHIEVRWDGQTAMLSDLGSTNGTLVNGSPVQDWQLADGDVIRAGHS
EILIRIV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtcgttgttacgtatcagcagaagagacgctcaccgaagggaggccggaatg
ggcatcgtttcacggttcgagcgtcgtcttcagggcgccgtcggtgatgtgttcgccagg
gtgttcggcggcaacgtcgtgccccaggaggtggaggcggcgctgcaacgtgaggccgct
gatcatgtccaagagctcgacggcgggcacctgttggcacccaacagctatgtgatcact
atcaattcctccgatcaccagcagttggacgccgatcacgacctcaccacccgcgcgttc
gccaaacacctgcaggattacatccgcgagcaaggctggcagacctacggcgaagtacac
gtggcgttcgaggcatcccctacgctgcacaccggacagttcagggctagcggccgggtc
gatccggacgtcggccgcggagctacaccagctcacagccctgaacgcacgccacaacga
cctgcaaacccgcaaccaggagctggccccatgacgcagaactcaggctacgacccgagc
cgtgagcccgcggagtccgatccacgcaaccgcgggtacgccccaccgcctgccggtcgc
ggcggcgcgcagaacggcgcgtaccgcgaggactacggtcgcggcgcggcgccctacggc
gccgactatccggcgccggagggtcagcagggttacggcgactaccagaacggctacgac
taccaacagggtggccaggcctacgggcagccggggtatcaggagccgggctacgccgcc
cagcagccgggctacgccgatcgcggttacgggcagccgggttatcaggagcccgcgtac
ggccagccgggctatcaggaaccgccggcctacggtcagccgggctaccaggagccgggc
tacggccagcagggttacgcccagcaaggttacggcgatcaggcgtacgcggatccggcc
tacggccagcaaggcgcgggctacgcccagccgggctacggccagcagggttaccaggag
cccggttacggcgagcaggcctacgccgagccgggtgcctacggccaggatgaccagggt
ggttacggccaggcctactcgcagcagcccggctacggcgcgcagccgggctatggcgcc
gcgcccgcgtatgccgctcccccacaggcgggttcgggctactccgcgactcttcagctc
gacgacggcagcggccgcacgtaccagttgcgtgagggcagcaacatcatcgggcgtggc
caggacgcgcatttccggctgcccgacaccggtgtctcgcgcaggcacatcgaggtccgc
tgggacgggcagaccgccatgctctcggatctgggttccaccaacggcacgctggtcaac
ggttctcccgtgcaagactggcagctcgccgacggggacgtgatccgcgccgggcactcc
gagatcctgatccgtatcgtctga

DBGET integrated database retrieval system