KEGG   Nocardia sp. CS682: DMB37_30660Help
Entry
DMB37_30660       CDS       T06040                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
noz  Nocardia sp. CS682
Pathway
noz00071  Fatty acid degradation
noz00280  Valine, leucine and isoleucine degradation
noz00281  Geraniol degradation
noz00310  Lysine degradation
noz00360  Phenylalanine metabolism
noz00362  Benzoate degradation
noz00380  Tryptophan metabolism
noz00410  beta-Alanine metabolism
noz00627  Aminobenzoate degradation
noz00640  Propanoate metabolism
noz00650  Butanoate metabolism
noz00903  Limonene and pinene degradation
noz00930  Caprolactam degradation
noz01100  Metabolic pathways
noz01110  Biosynthesis of secondary metabolites
noz01120  Microbial metabolism in diverse environments
noz01130  Biosynthesis of antibiotics
noz01212  Fatty acid metabolism
Module
noz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:noz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DMB37_30660
   00650 Butanoate metabolism
    DMB37_30660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DMB37_30660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DMB37_30660
   00310 Lysine degradation
    DMB37_30660
   00360 Phenylalanine metabolism
    DMB37_30660
   00380 Tryptophan metabolism
    DMB37_30660
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DMB37_30660
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DMB37_30660
   00281 Geraniol degradation
    DMB37_30660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DMB37_30660
   00627 Aminobenzoate degradation
    DMB37_30660
   00930 Caprolactam degradation
    DMB37_30660
Enzymes [BR:noz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DMB37_30660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 ACP_syn_III_C SDH_sah
Motif
Other DBs
NCBI-ProteinID: QBS43810
UniProt: A0A4P7H9B9
LinkDB All DBs
Position
complement(6788043..6789059)
Genome map
AA seq 338 aa AA seqDB search
MSDFENHSGTRPAAWYEGLTEAPDSPWADRELPPTDISYRTLTYEVTGRIARITFNRPEH
GNAITSDTPIELAHAVERADLDPRVHVMVVSGRGKGFCGGYDLSLFAESGFQGDDADSTT
GTVLDPMVQARNHNPWGTWDPMVDYAMMSRFNRGFASLLHANKPTVAKLHGFAVAGGTDI
ALYADQIICADDTKIGYPPTRVWGIPAAGMWAHRLGDQRAKRLLFTGDCLSGKQAEEWGL
AVESVPADELDERTEALLQRIARMPINQLMMAKLALNSALLQQGVANSGMISTVFDGISR
HTREGYAFQLRSATEGFREAVRERDEPYGDWKRAQFEK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagacttcgagaaccattccgggacccgtccggccgcctggtacgagggactcacc
gaagcccccgattcgccatgggccgaccgcgagctgccgcccacggacatcagctatcgc
accctgacctacgaggtcaccggccggatcgcgcgaataaccttcaaccggcccgagcac
ggcaacgccatcacctccgacactccgatcgagctcgcgcacgcggtcgaacgggccgac
ctcgacccgcgggtgcacgtcatggtggtttccgggcgcggcaagggtttctgtggtgga
tacgacctatcgctcttcgcggagagcggattccagggcgacgacgcggactccaccacc
ggcaccgtgctcgatccgatggtccaggcgcgcaaccacaatccctggggcacttgggat
cccatggtcgactacgcgatgatgagccggttcaaccgcggcttcgccagtctgctgcac
gccaacaagccgacggtcgccaaactgcatggcttcgccgtcgcgggcggtaccgacatc
gcgctctacgccgaccagatcatctgtgccgacgacaccaagatcgggtatccgcctacc
cgagtgtggggcatcccggctgcggggatgtgggcacaccgactcggtgatcagcgtgct
aagcggctgctgttcaccggtgactgtttatccggtaagcaggccgaggaatggggtctt
gccgtcgaatccgtaccggccgacgaactagacgagcgcacggaagcgttgctccaacgg
atcgcacggatgccgatcaatcagctgatgatggcgaagctggcgctcaacagtgcgttg
cttcagcaaggtgtggctaattcggggatgatcagcacggttttcgacgggatttctcgg
cacacccgggagggttatgcgtttcaattgcgttcggccactgaaggttttcgggaggct
gtgcgtgagcgggacgagccgtacggggactggaagcgggcgcagttcgagaagtag

DBGET integrated database retrieval system