KEGG   Neofusicoccum parvum: UCRNP2_1034Help
Entry
UCRNP2_1034       CDS       T03126                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
npa  Neofusicoccum parvum
Pathway
npa00020  Citrate cycle (TCA cycle)
npa00190  Oxidative phosphorylation
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01200  Carbon metabolism
Module
npa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
npa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRNP2_1034
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UCRNP2_1034
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UCRNP2_1034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: EOD52227
UniProt: R1EX82
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSALRLRQLAASAQFSRALRPQTRAFSSTRPVSKIFTNEPLRAKEASPYLSNKYPVIDHE
YDAVVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFGGQSQKFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFAIDLLMEDGVCKGVIAYNQED
GTLHRFRSHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVRKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDEKGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFTPGQK
HEPISADLGADSINVVDHVRTADGPKSTNDIRNAMQKTMQTDVSVFRTQESLDEGVRKIH
EVDASYSQVGTKDRSMIWNSDLVETLELRNLLTCAVQTAEAAANRKESRGAHAREDYPDR
DDENWMKHTLTWQREPHGKTELSYRAVNPNTLDENECKPVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccttaggttgcggcagctggccgcttcggcacagttttccagagcccttcgt
ccgcagacgcgcgccttctcgtccaccaggcccgtctccaagatcttcacgaatgagccg
ctccgcgccaaggaggcatcgccctatctcagcaacaagtaccctgtgatagaccacgag
tacgatgccgtggttgtcggtgctggtggctcgggtctccgcgccgcattcggtctggcc
gaggccggcttcaacaccgcgtgcatatccaagctgttccccacgcgttcccacaccgtc
gccgcccagggtggtatcaatgctgcgcttggaaacatgcacgaggatgactggagatgg
cacatgtacgacacggtcaagggctcggattggcttggtgaccaggatgccatccactac
atgacccgcgaggccccccagagtgtcattgagctcgagaactacggatgccccttctcc
agaaccgacgatggcaagatctaccagcgcgctttcggtgggcagtcccagaagttcggc
aagggtggccaggcataccgttgctgcgctgctgccgacagaaccggccacgctctgctc
cacactctgtacggccagtccctgaggcacaacaccaagtacttcatcgagttctttgcc
attgacctgctcatggaggatggcgtgtgcaagggtgtcatcgcctacaaccaagaggat
ggtaccctgcacagattccgctcgcacaacactgtcctggctaccggcgggtacggtcgt
gcttacttcagctgcacctcggcgcatacctgtaccggtgacggtatggccatggttgcc
cgtgctggcctccccaaccaggatcttgagttcgttcagttccaccccactggtatctac
ggcgctggttgcttgatcactgagggttcgagaggcgagggtggctacctccttaactcc
gagggtgagcgtttcatggagagatacgcgcctaccgccaaggatttggccagtcgtgac
gttgtctcccgttccatgaccatggaaatccgtgagggtcgtggtgttggccctgagaag
gaccacatttacctccagcttagccatctgcccccggagatccttcacgagcgtctcccc
ggtatctctgagacagcctcgatttttgccggtgtcgatgtccgcaagcagcccatcccc
gtcctgcctaccgtccactacaacatgggtggtattcccacgaagtacaccggtgaggtt
cttaccgtcgatgagaaaggcaacgataaggtcgttcctggtctcttcgcctgcggtgag
gctgcttgcgtctctgtccacggcgccaaccgtctcggtgccaactctctcctggatctc
atcgtcttcggccgtgccgtctctcacactattcgtgacaacttcactcccggtcagaag
cacgagccgatctccgcagacctcggcgctgattccatcaacgttgtcgaccacgtccgc
accgctgacggccccaagtcgacgaacgacatccgcaatgccatgcagaagactatgcag
accgacgtctccgtcttccgcacacaagagtcgctggacgagggtgtccgcaagatccac
gaggtcgacgcttcttactcgcaggttggcaccaaggaccgcagcatgatctggaactcg
gacctggtcgagaccttggagttgcgcaacctccttacctgcgccgtgcagacggccgag
gccgccgccaaccgcaaggagtcccgtggtgcccacgcccgcgaggactaccccgaccgc
gacgacgagaactggatgaagcacacgctcacctggcagagggaaccccacggcaagacc
gaactcagctaccgtgccgtcaacccgaacaccctcgacgagaacgagtgcaagcctgtg
ccgccgttcaagagaacatattag

DBGET integrated database retrieval system