KEGG   Neofusicoccum parvum: UCRNP2_1261Help
Entry
UCRNP2_1261       CDS       T03126                                 

Definition
(RefSeq) putative glucan-alpha- -glucosidase protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
npa  Neofusicoccum parvum
Pathway
npa00500  Starch and sucrose metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRNP2_1261
Enzymes [BR:npa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     UCRNP2_1261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19020241
NCBI-ProteinID: XP_007580583
UniProt: R1EWH5
LinkDB All DBs
Position
Unknown
AA seq 568 aa AA seqDB search
MFARFSLSGAALLLCADAFVIPAVLDSQKPLDGSALSDLVADKAHALSGQIGLLPASKKS
LDTWLDKEEDIAVDKLLANIAPSGRNAQHAAPGTVLASPSKEHPNYYYQWVRDAGITMAT
VVDLYLADPSSELSRTVLLPTLESYASISHKIQHTPNPSGDFSFPDLAGLGEPKFEVDGS
AFTSNWGRPQRDGPALRATALMKFMRAYNESNPGVWESRTSSTDDWFAKLYSAELPAHSI
IKADLEYVARHWPESGFDVWEEVRGRHFFTGMAQLRALREGAELATIFNDDGAATYYRAE
ATKLESMMRNDFWDKQGGYIRATRGSDAEWQRSGMDCSVLLGSIHGNALEPTYPDPAVFP
PHDDAVLVSLLKLVRDQRDRFPINAQPEQPEAGDDASFAEQDPLRPAGVGRYPEDAYDGY
ASPGPGSGNPWFLCTASVAEILFRTSEHLNQTAALEVSETGWEFWRGLVCPATVPSASIF
SSSSSSDCPLSWDRKRYAAGDGTGVVELAQQRLKAVGDGFLAVIKRHAKGDGSLSEQFDR
WTGYERGAEDLTWSYGAFLQAVWARQRL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccgcttctcgctttcgggcgccgccctgctgctgtgcgccgacgccttcgtc
attcctgccgtcctcgacagccagaagccgctggacggcagcgccctctcagacctcgtc
gccgacaaggcgcatgctctttccggccagatcggcctgctccccgcctccaagaagagc
ctcgacacatggctggacaaggaggaggacatcgccgtggacaagctgctggccaacatt
gcgccgagcggccgcaatgcgcaacacgccgcgccgggcaccgttcttgccagcccgtcg
aaagaacaccccaactactactaccaatgggtgcgtgacgccggcataaccatggccact
gtggtggacctctacctcgccgatccctcgtccgaactcagcaggaccgtcctcctcccc
acgctggagtcgtacgcgtccatctcgcacaagatccaacacacgcccaacccctcgggc
gacttctccttccccgacctcgctggcctcggcgagcccaagttcgaggtcgatggctcc
gccttcacctccaactggggccgtccccagcgcgacggtcccgctctgagagcgacggcg
ctcatgaagttcatgcgcgcatacaacgagagcaacccgggcgtgtgggagtccaggacg
tcgtccacggatgactggttcgccaagctgtacagcgccgagctgcccgcgcacagcatc
atcaaggccgacctcgagtacgtggcgcgtcactggcccgagtccgggttcgacgtgtgg
gaggaggtccgcggccgccacttcttcaccggcatggcgcagctgcgcgctctccgcgag
ggcgccgagctcgccaccatcttcaacgacgacggcgccgccacgtactaccgcgccgag
gccacgaagctggagagcatgatgcgcaacgacttctgggacaagcagggtggctacatc
cgcgccacccgcggcagcgacgccgagtggcagcgctccggcatggactgcagtgttctg
ctgggcagcatccacggcaacgccctcgagcccacctaccccgaccccgctgtcttcccg
ccccacgacgacgccgtgctggtctctctcctcaagctcgtccgcgaccagcgtgatcgc
ttccccatcaacgcccagcccgagcagcccgaggccggcgacgacgcttccttcgccgag
caggaccctctgcgccctgccggcgtcggccgctaccccgaggacgcgtacgacgggtac
gcctctcccggccccggctccggcaacccgtggttcctgtgcaccgccagcgtcgccgag
atcctgttccgcacctcggagcacctcaaccagacggcggccctcgaggtcagcgagacg
ggctgggagttctggcgcggtctcgtctgcccggccaccgttcccagcgcctccatcttc
tcgtcgtcatcgtcgtccgactgcccgctgtcgtgggatcgcaagcgctacgctgccggc
gacggcactggtgtggtcgagcttgcgcagcagaggttgaaggccgtcggcgacggcttc
ctggccgtgatcaagaggcacgccaagggcgacggttcgctgagcgagcagttcgaccgg
tggacgggttacgagcgcggcgcggaggacttgacgtggagctacggcgcattcttgcag
gctgtgtgggcgaggcagaggctgtag

DBGET integrated database retrieval system