KEGG   Neofusicoccum parvum: UCRNP2_1418Help
Entry
UCRNP2_1418       CDS       T03126                                 

Definition
(RefSeq) putative glutathione s-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npa  Neofusicoccum parvum
Pathway
npa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UCRNP2_1418
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:npa02000]
    UCRNP2_1418
Enzymes [BR:npa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     UCRNP2_1418
Transporters [BR:npa02000]
 Other Transporters
  Pores ion channels [TC:1]
   UCRNP2_1418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_N_4 REC104
Motif
Other DBs
NCBI-GeneID: 19020414
NCBI-ProteinID: XP_007580738
UniProt: R1H052
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MAPPDADIYPEATGPAIETVKAHQTPAPLKLYAGWFCPFVQRVWVVLEEKRIPYQYIEVN
PYHKPPSLLALNPRGLVPTLEHAGKPLYESTVVADFLDDAYPGHGAALHPRDPYEKARQR
IWMEYVTSRIIPAFHRFLQFQVRQWVFDEFKGGSGIPKEGEAGDDAVWKRWRKYADAIES
RESFRKTTSEAEHYRPLYKRYADDIAQSELAKSIRAGRGVV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcccgacgccgacatctaccccgaagccaccggcccagccatcgaaaccgtg
aaagcgcaccaaacccccgcccccctcaagctctacgcgggctggttctgccccttcgtg
cagcgcgtctgggtggtgctcgaagaaaagcgcatcccgtaccaatacatcgaggtcaac
ccgtaccacaagccaccctccctcctcgcgctcaacccgcgcggcctggtgccgacgctc
gagcacgccggcaagccgctgtacgagagcaccgtcgtcgccgacttcctggacgacgcg
taccccggccacggcgccgcgctgcacccgcgcgacccgtacgagaaggcgaggcagagg
atttggatggagtatgtgacgagtaggattattccggcgtttcatcggtttttgcagttt
caggtccggcagtgggtgttcgacgagttcaagggcggctcgggcatcccgaaggagggc
gaggcgggcgatgatgcggtgtggaagaggtggcgcaagtatgccgacgcgatcgagagc
agggagagcttcaggaagacgacgagtgaggctgagcactacaggccgctgtataagcgc
tacgccgacgacattgcgcagtcggagctcgccaagtccatccgtgctggtaggggggta
gtgtga

DBGET integrated database retrieval system