KEGG   Neofusicoccum parvum: UCRNP2_3980Help
Entry
UCRNP2_3980       CDS       T03126                                 

Definition
(RefSeq) putative alanine aminotransferase protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
npa  Neofusicoccum parvum
Pathway
npa01100  Metabolic pathways
npa01200  Carbon metabolism
npa01210  2-Oxocarboxylic acid metabolism
npa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_3980
   00220 Arginine biosynthesis
    UCRNP2_3980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:npa01007]
    UCRNP2_3980
Enzymes [BR:npa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     UCRNP2_3980
Amino acid related enzymes [BR:npa01007]
 Aminotransferase (transaminase)
  Class I
   UCRNP2_3980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 19023228
NCBI-ProteinID: XP_007583269
UniProt: R1ENW4
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MKALTIDNINPHIKAAKYAVRGELAVKSEEYRARLAKGDKGDLPFDTVISANIGNPQQLD
QKPITFFRQVASLLENPKLLEHEDVLKSALGYKQDVIDRAHKLLKDVGSVGAYSQSQGAP
GIRDEVAKFIERRDGYPADPANIFLSNGASAGVNALLHVICQNEKSGILIPIPQYPLYTA
TLSILNATPVPYYLDESAHWGTSLADIKASYEKAVADGVDVRAIVVINPGNPTGASLSAA
DIRGVLEFAAEKKLVVMADEVYQTNVFVGEFISFKKALRDLQKEQPGKFDELELASLHSV
SKGMVGECGHRGGYYEMVGFDPQVKDEIYKFVSIQLCPPVIGQCIVEMMVNPPKEDGPSY
PLYQHEYDSIFRSLYERANALYDAFKKMEGVECASPAGSMYLFPTITLPPKAIEQAKKEG
RQADEFYALRMLDATGVCTVPGSGFGQKEGTYHFRTTFLAPGTDWVGRIVEFHRKFMEEF
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctcaccattgacaacatcaacccgcacatcaaggcggcaaagtacgccgtg
cgtggcgagcttgcagtcaagagtgaggagtaccgcgctcgtctggccaagggcgacaag
ggcgacctgcccttcgacacagtcatctctgccaacatcggcaacccgcagcagctcgat
cagaagcccatcacattcttccgccaggtcgccagtcttctggagaacccgaagctgctg
gagcatgaggacgtgctgaagagcgctctgggatacaagcaggacgtaatcgacagggcg
cacaagctgctcaaggacgtcggcagcgtgggcgcctacagccagagccagggtgctccc
ggaattagggacgaggttgccaagtttatcgagagacgcgacggctacccggcggacccc
gccaacattttcctcagcaacggcgcctctgctggtgtgaacgcgctcctgcacgtcatt
tgccagaatgagaagagtggcatcctcatcccgatccctcagtaccctctgtacaccgcc
actctctccatcctgaacgccacgcccgtaccatactacctcgatgagtcagcgcactgg
ggaaccagcctggcggatattaaggccagttacgagaaggctgttgccgacggcgttgat
gtgcgcgccatcgtcgtaatcaaccctggcaaccccactggtgccagcctgagtgcggcc
gatatccgtggcgttctggagttcgccgcggagaagaagctggtcgtgatggcggacgag
gtctaccagacgaacgtcttcgttggcgagttcatctccttcaagaaggcgctgcgtgac
ctgcagaaggagcagcccggcaagttcgacgagctggagcttgcatccctgcactccgtg
tccaaaggcatggttggcgagtgcggccaccgtggtggttactacgagatggtcggattc
gaccctcaggtcaaggacgagatttacaagttcgtctccatccagctttgcccgcctgtc
atcggtcagtgcatcgtcgagatgatggtcaaccctcccaaggaggacgggccgagttac
ccactgtaccagcacgagtacgacagcatcttcaggagcctctacgagcgcgcaaacgcg
ctgtacgatgccttcaagaagatggagggtgttgagtgcgcttctccagccggctcgatg
taccttttcccgactattacgcttccccccaaggctattgagcaggctaagaaggagggc
cgccaagctgacgagttctacgcactgcgcatgctcgatgcgacgggtgtctgcaccgtt
cccggctccggtttcggccagaaggagggaacgtaccacttccgcaccactttcctcgca
cctggcactgactgggtcggccgcattgtggagttccaccgcaagttcatggaggagttc
aagtag

DBGET integrated database retrieval system