KEGG   Neofusicoccum parvum: UCRNP2_41Help
Entry
UCRNP2_41         CDS       T03126                                 

Definition
(RefSeq) putative histone deacetylase protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
npa  Neofusicoccum parvum
Brite
KEGG Orthology (KO) [BR:npa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npa03036]
    UCRNP2_41
Enzymes [BR:npa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UCRNP2_41
Chromosome and associated proteins [BR:npa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     UCRNP2_41
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 19023360
NCBI-ProteinID: XP_007579369
UniProt: R1EZE7
LinkDB All DBs
Position
Unknown
AA seq 1103 aa AA seqDB search
MEPDPQLQKPVKRLSINTAAKTPLPSSPAMDSPHRRSSSYYSRMPKSPTPGAPLPSPLNR
STSSLGVRPASPALSRRSSIVSLQGASADSSHTPRKSVSRRTSGNLRSSGSSALASPRSV
PIEEAPPLTAQKVASDFFAKELEYHKNEDLSTQTVVILHDACYGHRFSRPKTTKSALSMI
VERPERIHAGILGISTAYVRFAERHAGGPHAPHPKRDPPQELPFTIRRTSRTLDITSPFV
TNVHGTKWMEELQTMCNAAGEKLALNGKELARVEEPGQPEKEKFHEGDLYLSSESLNAFQ
GALGGVCDGIDAVFSGTKDKPRNAFVCVRPPGHHCSADFPSGFCWLNNVHVGIEYAAQTH
GLTHAAIIDFDLHHGDGSQAIAWERNTKVANMPAKQPKNAAPLKRTQIGYFSLHDINSYP
CEWGDIEKVQAASLCIENAHGQTVWNVHLQPWKTEEEFWKLYETRYLALVEKARVFLRAH
TQRLRASPSQPQPKAAIFISAGFDASEWEGQGMQRHKVNVPTDFYARFTQDIVKMSQEEN
LGVDGRVISVLEGGYSDRALASGVLSHLSGLCEGQKIPVAKKEPIALNGLGNEMMIDHPV
LQQAYENGEKTLRYNVEWWHEANLTALETMVYPPPPPAPKKQQRGGTQGNFATPTQSFTA
KVVDPEKFIRNASGHLVPIRELPRPPTPPPPDVNWIIAAHELCKLLIPTDRQTKSCKPEE
LSEPRTKKEKVLPPEVPVNPSGRQLRDRKPKVTNYSEPPSDDENFHTRASSYAQTSKTAA
PTRTAKAKSESPTDDMDQLTSGIKKITLKMPTREEHDARQAAAAAAEKEVKKPVAPKAAT
KKAPAARGTKTTAASKKAAAKETKPTPPTTEQSEDAMSIASYTSASNQSEPMIVQPEPMV
AESAAVIGQPEPAVAASEASLAVPGPAEAQHERTLSRQSIENMAEQIMNSFPPQLASPSE
LSEGSTPQGLLETAAPVRVPEVTPRPDSPPPPPPATMPQFIQYDPGESGHGTTATAGPGA
DGAPTVLQWMAPNSDPEASGSHGPPSSPGRKQKQALPVFTPNSFIPFGQAAAPRVEPGHE
ETQVKQETEAQAMGTLDVPGAKE
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgacccgcagctgcagaagcccgtgaagcgcctgtccatcaacaccgccgcg
aagaccccgctgccctcgtcgcccgcaatggactcgccgcaccgccgctccagctcctac
tacagccgcatgcccaagtcgcccacgcccggcgcccccctccccagcccgctcaatcgc
agcaccagcagcctcggcgtgcgccccgcgtcgcctgcgctgtcgcgtcgcagctccata
gtctcgctccaaggcgccagcgccgacagctcgcatacccctaggaagtccgtgtcgcgc
cgcacatctggcaacctcagatcctcgggctcctctgcgctggcgtccccgcgctccgtc
cccatcgaggaggccccgccgctcactgcccagaaagtcgcctccgatttcttcgcgaag
gagctggaataccacaagaacgaggacctctccacccagacggtggtcatcctgcacgat
gcctgctacggccaccgcttctcccgtcccaagaccaccaagagcgcgctgagcatgatc
gtcgagcgcccggagcgcatccacgccggtattctgggaatatccacggcctatgtcaga
ttcgccgagcgacacgctggagggccgcatgcgccgcacccgaagcgcgacccacctcag
gagctcccgttcactatccgacgcacgtcccgcactctcgatattacatcccctttcgtg
acaaatgtccacggcacaaagtggatggaggagctgcagacaatgtgcaacgctgctggg
gagaagctggcgctgaatggcaaggaacttgccagggtcgaggaacccggccagcccgag
aaggagaagttccacgaaggggacttgtacctctcctcggaatcattgaacgccttccaa
ggtgcccttggtggcgtgtgcgacggcattgatgccgtgttctcaggcaccaaagacaag
ccgcgtaacgcttttgtttgcgtgcgacccccgggacaccactgctctgcagacttcccc
tctggattctgctggctgaacaacgtccacgttggaattgagtatgccgcgcagacacac
ggtctcactcacgctgccatcattgacttcgacctccaccatggcgatggttctcaggct
atcgcttgggagcgcaacacgaaagttgcgaacatgcccgccaaacaacccaagaacgcg
gcgcctctcaagagaacccagatagggtatttcagtctccacgatatcaactcgtatcct
tgcgagtggggtgatattgaaaaggtgcaggcagccagtctttgcatcgagaacgcccac
ggtcagacggtttggaacgtgcatctgcagccctggaagactgaagaggagttctggaag
ctgtacgagaccagatacctcgcccttgttgagaaagcccgcgtcttcttgcgggcgcac
acccagcgccttcgcgcctctccgagccagcctcagcccaaggcggccatcttcatctca
gccggtttcgatgccagcgagtgggagggccagggaatgcagaggcacaaagtcaatgtg
cctactgacttttacgcccgcttcacccaggatattgtcaagatgtcgcaggaagaaaat
ctcggtgtcgacggcagggtgatcagtgtccttgaaggcggttacagtgacagggctctg
gctagtggagtccttagccacttgagtggcctttgcgagggacagaaaatacccgttgca
aagaaggaacctattgcgctgaatggtcttggaaacgagatgatgatcgatcatccagtg
ctgcaacaagcatacgagaatggcgaaaagactcttcgctataacgttgaatggtggcat
gaagccaatttgacggcccttgagaccatggtctaccctccacctcctcctgctccgaag
aagcaacagcgcggtggtacccagggcaacttcgctacacctacacaatcgttcacagcc
aaggtcgtcgaccccgagaaattcattcggaatgcttctggtcatctggtgccaattcga
gaactccctcgtcctccgactcccccaccgccggatgtcaactggattattgcagcgcat
gagctgtgcaagctgctcatccccaccgaccgccagaccaagagctgcaaacccgaggag
ctttccgaaccacgcacgaagaaggagaaggttctgccgcctgaggttccggtcaatccg
tctggaagacaactgcgcgacaggaagcccaaggtcaccaactactctgagcctccctca
gacgacgagaattttcatacacgagcttcgagctacgctcagaccagcaagaccgctgct
ccgaccaggacagcaaaggcgaagagcgaaagccccaccgacgatatggatcagctcact
tcgggtatcaagaagatcacgttgaagatgcccaccagggaagagcatgacgctcggcag
gcagccgctgctgccgcagagaaggaagtcaagaagcctgttgcacccaaggcggcgaca
aagaaggctccagcggctcgtggtaccaagacaacagcggcctcgaagaaggcggctgca
aaggagaccaagcccacgccacccaccacggaacagtcggaagatgccatgtccattgct
tcctacacgtctgcatctaaccagtccgaacctatgattgttcagcccgagcccatggtt
gctgagtctgcggctgtgattggtcagcccgagccagccgttgctgcgtcggaggccagc
ctggccgttccagggccggcggaggcacagcatgagcgcactctgtcccggcagtctatc
gaaaacatggcagagcagatcatgaattcgttcccgcctcagctagcctcaccttctgag
ctttcggaaggatcgacgccgcagggcttgcttgagacggctgcacctgtgcgcgtccct
gaggtgacgccgcggcccgactcgcctcctccgccaccccctgcgacgatgccgcagttc
atccagtacgacccgggcgagagtgggcatggtacgacggcaacggctggccctggtgca
gatggcgcgccaacggtgctgcagtggatggctccgaactcggaccctgaggcttcggga
tcgcacgggccgccgtcctccccgggccgcaagcagaagcaagcgttgccggtgtttacg
ccaaacagtttcatcccgtttggccaggctgcggctcccagggtcgagccggggcatgag
gaaacgcaggtcaagcaggagacggaggcgcaggcgatgggtaccctggatgttcctggt
gccaaggagtga

DBGET integrated database retrieval system