KEGG   Neofusicoccum parvum: UCRNP2_4469Help
Entry
UCRNP2_4469       CDS       T03126                                 

Definition
(GenBank) putative sorbitol dehydrogenase protein
Organism
npa  Neofusicoccum parvum
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_7 TrkA_N Sacchrp_dh_NADP ADH_N_assoc Pyr_redox Shikimate_DH AlaDh_PNT_C Pyr_redox_2 FAD_binding_3 NAD_binding_3 NTP_transf_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: EOD48777
UniProt: R1EMI3
LinkDB All DBs
Position
Unknown
AA seq 376 aa AA seqDB search
MLEAIKNLTTRMGSNPNKTMRAVRFHGQRDLRLEDIPEPQVGKGQVKLKPAWVGICGSDL
HEYMGGASICPTTPHPITGETVPLTFGHEFSGVIEEVGEGVTDFKVGDRVCVQPIIYDGD
CGACTEGLINCCYKNGFIGLSGWGGGLAEHIVTPQSCLYKLPENVSLEIGALIEPLAVGW
HAVNISPWKPESSVLVLGGGPIGLSVIQALRARGATKIIVSEVSPRRKEFAKQFGAHYVL
DPTKDDVPARCRELCEKQGVHVVFDCAGVQAGLDAAVQAVRARGTIVNIAIWEKRCSIFP
NDFCFKERSYIGVATYQAGDFQDVLNAISEGRLKPDEMITKRIELDQVEAEGFKTLIDDK
DNQVKVLVRANRFDIT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagccatcaagaacctgacgaccagaatgggctcaaatccgaacaagaccatg
agggcggtgcgcttccacggccagcgcgacctgaggctggaggacattccagaaccgcag
gtgggcaagggccaggtcaagctgaagccggcctgggtcgggatctgcgggagtgacctg
cacgagtacatgggcggcgccagcatctgccccaccacccctcatccaatcaccggcgaa
actgtgcctctcacctttggccatgagttcagcggagtcatcgaggaagtcggcgaaggc
gtgacagacttcaaggtcggagaccgtgtgtgcgtgcagcccatcatctacgacggggac
tgcggcgcatgcacagaagggctgatcaactgctgctataagaacggcttcatcggcttg
agcggctggggcggtggccttgcagagcacatcgtcacaccccagtcatgtctgtacaag
cttccggaaaacgtgtcgctggaaataggcgctctcatcgaacccttggcagtaggctgg
cacgccgtgaacatttcaccctggaaacccgaaagctccgttcttgtccttgggggcggg
cccatcgggctctccgtaatacaagccttgcgtgcccgcggcgccacgaagatcatcgtc
tctgaagtctccccccggcggaaggaattcgccaagcagttcggcgcccactacgtgctc
gaccccaccaaggacgacgtgccggcacggtgtcgggagctctgcgagaaacaaggcgtg
catgtcgtgttcgactgcgccggcgtgcaagcgggcttggacgcggctgtgcaagctgtg
cgcgccaggggcaccatcgtcaacatcgctatctgggaaaagcgctgcagcatcttcccc
aacgacttctgcttcaaagagcggtcttacatcggagtggcgacctatcaggctggtgac
ttccaggatgttctgaatgcgattagtgagggcaggctgaaaccggacgagatgatcacg
aagaggattgagctggaccaggtcgaagctgagggcttcaagacgttgattgacgataag
gataaccaggtgaaggtactggtgagggcgaatcgcttcgacataacttga

DBGET integrated database retrieval system