KEGG   Neofusicoccum parvum: UCRNP2_4705Help
Entry
UCRNP2_4705       CDS       T03126                                 

Definition
(RefSeq) putative hexokinase protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
npa  Neofusicoccum parvum
Pathway
npa00010  Glycolysis / Gluconeogenesis
npa00051  Fructose and mannose metabolism
npa00052  Galactose metabolism
npa00500  Starch and sucrose metabolism
npa00520  Amino sugar and nucleotide sugar metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01200  Carbon metabolism
Module
npa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
npa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCRNP2_4705
   00051 Fructose and mannose metabolism
    UCRNP2_4705
   00052 Galactose metabolism
    UCRNP2_4705
   00500 Starch and sucrose metabolism
    UCRNP2_4705
   00520 Amino sugar and nucleotide sugar metabolism
    UCRNP2_4705
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UCRNP2_4705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:npa04131]
    UCRNP2_4705
Enzymes [BR:npa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UCRNP2_4705
Membrane trafficking [BR:npa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UCRNP2_4705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19024026
NCBI-ProteinID: XP_007583986
UniProt: R1ELY0
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MVGLGPRKPPSRKGSMADVPKDLLATIKRLEELFTVPADKLKEISDHFVTELEKGLSKEG
GSIPMIPTWCMGFPTGDEQGTFLALDMGGTNLRVCEVSLTEEKGEFDIIQSKYRMPQELK
TGTAEELWEYVADCLQQFVEYHHEGEDLKQLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGKDVVPPFEAALKERGVPIKLTALVNDTTGTLIASAYTDPRMKIGCIFGTGCNAAY
MEDCGSIPKLEHMKLPPNELMGINCEWGAFDNEHKVLPRTKYDIIIDKESPRPGQQSFEK
MIAGLYLGEVFRLVVLDLHEDPHCHLFEGQDVSKLKKPYTMDSSFLATIEEDPFENLQET
ADLFQNTLGLVLKKPELELCRRLAELIGTRAARLSACGVAAICKKKGWTECHVGADGSVF
NKYPHFKARGAQALREIFGWPKGKRDPIEIVPAEDGSGVGAALIAALTLKRVKEGNHAGI
RDPKGLLEGLNP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtctcggtcccaggaagccaccgtcccgcaagggttctatggccgatgtgcct
aaggatctccttgcgactatcaaacgcctcgaggagctcttcaccgtgcccgccgacaag
ctcaaggagatcagcgaccactttgtcaccgagctggagaagggcctgtccaaggagggc
ggcagcattcctatgattcccacctggtgcatgggcttccccaccggtgatgagcagggc
acgttcctcgccctggacatgggcggcaccaacctccgtgtttgcgaggtctccttgacc
gaggagaagggagagttcgacatcatccagtccaagtacaggatgccccaggagctgaag
acgggcaccgccgaggagctgtgggagtacgttgccgactgcctgcagcagttcgtcgag
taccaccacgagggcgaagacctcaagcagctcccgctgggtttcaccttctcctacccc
gccacccaggactacatcgaccacggtgttctgcagaggtggaccaagggcttcgacatc
gatggtgtcgagggcaaggatgtcgtcccgcctttcgaggctgcgcttaaggagaggggc
gttccgatcaagctcactgcgcttgtcaacgataccaccggtacccttattgcctcggcc
tacaccgacccgcgcatgaagattggatgcattttcggcactggctgcaacgccgcgtac
atggaggactgcggttccatccccaagctcgagcacatgaagctcccccctaatgaactc
atgggcatcaactgcgagtggggcgcttttgacaacgagcacaaggttctgcccaggacc
aagtatgacatcatcatcgacaaggagtctccccgccctggtcagcagtcgttcgagaag
atgattgctggtctctacctaggagaggtcttccgcctggtcgtccttgacctccacgag
gacccgcactgccacctgtttgagggccaggatgtgagcaagctcaagaagccctacacc
atggactcttcgttcctggctactattgaggaggatccgttcgagaacttgcaggagact
gccgacctcttccagaacacgctcggcctggtcctcaagaagcccgagctcgagctgtgc
cgtcgcctggccgagctgatcggcacccgtgccgctcgcctctcggcctgtggtgtcgct
gccatctgcaagaagaagggctggactgagtgccacgtcggcgctgacggctccgtcttc
aacaagtacccgcacttcaaggctcgcggcgcccaggccctccgcgagatctttggttgg
cccaagggcaagcgtgaccctattgagatcgtccccgctgaagacggttctggtgtcggt
gccgccctcatcgctgccctcaccctcaagcgcgtcaaggagggcaaccacgccggtatc
cgcgaccccaagggtctgctcgagggcctcaacccgtaa

DBGET integrated database retrieval system