KEGG   Neofusicoccum parvum: UCRNP2_5478Help
Entry
UCRNP2_5478       CDS       T03126                                 

Definition
(RefSeq) putative isocitrate dehydrogenase protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
npa  Neofusicoccum parvum
Pathway
npa00020  Citrate cycle (TCA cycle)
npa00480  Glutathione metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01200  Carbon metabolism
npa01210  2-Oxocarboxylic acid metabolism
npa01230  Biosynthesis of amino acids
npa04146  Peroxisome
Module
npa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRNP2_5478
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UCRNP2_5478
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UCRNP2_5478
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UCRNP2_5478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh Phe_ZIP X
Motif
Other DBs
NCBI-GeneID: 19024876
NCBI-ProteinID: XP_007584751
UniProt: R1EJP5
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MRPSTLSASTASRAFRCAAPASRYPTVPRTFTSLSAVRPAAKSAISAAPSSRLASGLFSA
SQTSFAAPVALSIAGQRRTMASAKKIQVKNPVVELDGDEMTRIIWQTIKDKSPSYLDIDL
KYYDLGILYRDETNDQVTLDAAEAIKKYSVGVKCATITPDEARVKEFNLKKMWLSPNGTI
RNHLGGTVFREPIVIPRIPRLVPGWKQPIIIGRHAFGDQYRAKDRVIEEEGTLEMVFTPK
GGKPETIKVFDFPNGGGVAQTQYNTAESISGFAHACFKYAIGKKMPLYMSTKNTILKKYD
GRFKDIFQEIYEKEYKSEFEAANIWYEHRLIDDMVAQMIKSEGGFVAALKNYDGDVQSDI
VAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHFREHQKGKETSTNPIASIFAWTRGL
AKRGELDGTPEVVAFAEALEKACVDTVDVDGIMTKDLALACGKKDRDAYVTTNGYLDAVE
RRLKQGLKEKL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccttctaccctctccgccagcaccgcctccagggccttccgctgcgctgctcct
gcctcccgctatcccactgtccccagaaccttcacctctctcagcgccgtccgccccgct
gcgaaatccgctatcagcgcagctccgagctcccgtctcgcctctggcctgttctctgcc
agccagaccagctttgccgcgcctgttgcactgagcattgcaggccagaggagaaccatg
gcttccgccaagaagatccaggtcaagaacccggtggtcgagctggacggagacgagatg
accaggatcatctggcagactatcaaggataagagcccaagttaccttgacattgacctc
aagtactacgatctgggcattttgtaccgtgatgagaccaacgaccaggtcacgcttgat
gccgctgaggctatcaagaagtactcggttggcgttaagtgtgctaccatcacccccgac
gaggcacgtgtcaaagagttcaacctcaagaagatgtggctctcgccaaacggtacgatc
aggaaccacctgggcggtactgtgttccgcgagccaatcgttatcccccgcattcctcgc
ctcgtacctggttggaagcagccgatcattatcggtcgccacgccttcggtgatcagtac
cgcgctaaggaccgcgtcatcgaggaagagggcacccttgaaatggtcttcactcccaag
ggcggcaagcctgagaccatcaaggtgttcgacttccccaacggcggtggtgttgcccag
acccagtacaacacggctgagtccatctctggtttcgcgcacgcctgcttcaagtatgcg
attggcaagaagatgccgctctacatgagcaccaagaacactatcctcaagaagtacgat
ggtcgcttcaaggacatcttccaggagatctacgagaaggagtacaagtcggagttcgag
gctgcgaacatctggtacgagcaccgtctcatcgacgacatggtcgcgcagatgatcaag
agcgagggtgggttcgttgccgctttgaagaactacgatggtgatgtccagtccgacatc
gttgcccagggcttcggcagtctgggtttgatgacctcggtcctcatcactcctgacggc
aagaccttcgagtcggaggctgcgcacggcaccgtcactcgccacttccgtgagcaccag
aagggcaaggagaccagcactaatccgattgcctccatctttgcctggacgcgtggtctg
gccaagcgtggagagcttgacggcactcctgaggttgttgcctttgccgaggcgcttgag
aaggcctgcgttgacactgtcgacgtcgacggtatcatgactaaggacctagcgctcgcc
tgcggtaagaaggacagggatgcgtacgtcaccacgaacggctaccttgatgctgttgag
aggaggttgaagcagggactcaaggagaagttgtaa

DBGET integrated database retrieval system