KEGG   Neofusicoccum parvum: UCRNP2_6119
Entry
UCRNP2_6119       CDS       T03126                                 

Definition
(GenBank) putative viral a-type inclusion protein
Organism
npa  Neofusicoccum parvum
SSDB
Motif
Pfam: Fib_alpha Spc7 MscS_porin CCDC92
Other DBs
NCBI-ProteinID: EOD47140
UniProt: R1G6N6
LinkDB
Position
Unknown
AA seq 1936 aa
MSRASVDTKKPAAAPKPVDEDLESAAPKAADPEDEEESAPSVAESVRELETPVPADASAA
DEPVRSPRASRDAQEIMMDLTREFDQRKALESKIQELEANIEELQADKEAADNKASEALR
DLERAREDHSSALDSANSSWETQTEDIRRRNEDLKVKAVELEDVKHRLEQTKDEASKVSE
EKEDLANTLEELQKELERASAEIDEREKAVEEEKRLASEKTKHLEEELEALKTSSAEQLK
HLEQELANVRNFQEALVSQKNLADERVQQLEQDLKASSGSSDDQVNRLKEIQDEMKLSTE
KISQLESELATAKNNANDEVARLTDELEAEKKTTSEKISQLESELAAAKENTGDEVKALT
EQLEAEKKTSAEKIGQLESELAASKESTGDEVSRVKAELEAERKMAAEKIEELETQLSSA
KDGSGEEVSRLKHELDVERRSAADKIIELETQLSSAKVDTNEEVNRLKAELEAERNTTAN
KIIELEALLSSAKDSSNDEVSRLKDELEAERKTASDKITELETQVSSAKDGPNDEVVALK
AEAEKYQKQLQEERETLTNTIESLEKQISDLKAEVTEATEKHAAALSGERETSAAAIVAI
EEKLVAAEKDHAEKLRMLEENLKNHEEERGALKTQSELDELLEQAKKDADEKVAAVEAEA
KKLQEDLQKHQEDLQKHEEERSTLKSQHEIEEIVEQVKKEAAEKLAAAEAEKLKLQEDLQ
KLGEERGALKSQTELDELVEQVKKDAAEKIAAAEAESKKLQEDLEKEKSETAAYEEKMAT
IEREASERAQKILDDYNQAQNALSKAKEDNENLTTQLDAFQETVKAAQDSISDKANQFEE
LQKQYEQSKQRTAELDNTMDEVRQKAYEDLEHAKSESKAFADKLKDLEDESAEANRRMEA
QRAAYEVLKAEHANVSSESEERLQKRIQELEHESLKAAEEAAAHQEKIAAIEKEMAERLE
REQETLKKQLAELDEKRAAMDTEKEAMQSITTQLQDKVAELEKEAAEKARLVEDSSNNLK
RQSVEYDSDKASLQSAIESLQDKIRGLEQERSETETVASVEVEKLKKQIADFEQEKGSAD
SIIAALQDKVTVLQQEKADGSRGADDDSEKLNQRIQELEMDKASMESTITALQDKVIGLQ
QDTSDKSSDLVAEVERLRQECSELEQEKAEMVRRAQDAAQSNAIATEKHQDDYNFLLQRL
ERSTQEHAAVVEQLQDDYTLGLQKIADSARIKTRKQSLHSLTDEIVQLITDKAHLEDDLE
ARDGALQNARETVKDLREKMSGEHQGEIAHDEIMSNLQNRIKELEQQRSDEVDGLTSELE
SKTHQITELCTRIETVAEELDAKKTETQDALATIDFHQRATKAVQAEYEEQVQEIVRVYN
VQLEESAQTLQGRDHEIESLRQTIDNLHLELEEAVKGPNVFEVRQEFEDRTRKLEGRING
LTEEKDVLEKQLFAARQANEEDADKIPQLHEELDRLHEEIEELQSALEEAERQLNDAHDR
LKGVDKEHSKVIKSLQDKIADAEYKMADKIAEKDAEMSRMNQELAARRQSIDEAMPQLDD
YRAMKRDLDEKTMELEEKSRQVDGLMQTLRALDEAHEERDGHHASGLEKMKRELESELAR
VRVELENEIVRLKTLNQQLTEANERLEHEKTGKEALLKQKLAELEQLKKEAEESRTEHDQ
LLEKLWSEHAKERSSMEQTLEQIYEQEKAAIEQNFKHEHSTMKESLEAEIARVKKQHDET
DKLYQQALEEALKEERAKLHMEAASREEQIKAEMKKTEQVTVQKLTDLLDVAKAEINDQF
SEIKRAEAEIDRLNTEIDKLHVEIAGTRESPRVAELIRECETYKQRLIELETELASYRQN
GGAPPQYRNSGEEERDNLNDKSASGQMAGIREQVRQLGQLNDELISHNQDVSGFIRNGFG
TPRKQSVNIEASPADS
NT seq 5811 nt   +upstreamnt  +downstreamnt
atgtcgcgggcatcagtcgacactaagaagcctgctgctgcgcctaagcctgtcgacgaa
gatcttgagagtgccgctcccaaggcagctgaccccgaggacgaggaggagtcggctccg
tccgtagctgaatcagtcagagaactcgagacgcctgtgccagcggacgcttccgccgcc
gacgaacccgtaagatcaccccgcgcctcccgagacgcccaagagatcatgatggatctt
acccgggagttcgaccaacggaaggctcttgagtccaagattcaagagcttgaggcgaac
atcgaagagctccaggctgacaaggaagcggcggacaacaaggcttccgaggctctgcgg
gatttggaacgcgcaagagaagatcatagctccgcgctcgactctgccaactccagctgg
gagactcagaccgaggatattcgccgtcgaaatgaggatctcaaagtcaaggctgtcgaa
cttgaggatgtcaagcatcgtcttgaacagaccaaggatgaggcctccaaggtcagcgaa
gagaaggaagatctcgccaacactcttgaagagctgcagaaggagcttgaacgcgcctcg
gcagaaatcgatgagcgcgagaaggctgtcgaggaagagaagcgcctcgcatctgagaag
accaagcatctcgaggaggagctcgaggcactcaagacttcctctgctgagcagctcaag
caccttgagcaagagctagccaacgtcaggaatttccaagaagcccttgtgtcccagaag
aatctcgcggacgagcgagttcaacaactggagcaagacctcaaggcttccagcggtagc
tccgacgaccaggtgaaccgcctcaaggagatccaggacgagatgaagctgtcgaccgag
aagatctctcagctcgagtctgagttggcgaccgccaagaacaacgcaaacgatgaggtt
gctcgccttactgatgagcttgaggctgagaagaagactacctcggaaaagattagccag
ctcgaatctgaacttgccgccgccaaggagaacaccggcgatgaggtcaaggctctcact
gagcaactcgaggcggagaagaaaacttccgcagagaagatcggccagcttgagtccgag
ctcgcggcttccaaggaaagcactggagatgaggtcagccgggtcaaggcagaacttgaa
gccgaaaggaagatggcggccgagaagattgaggagcttgagactcagctttcgtctgcc
aaggatggctccggcgaggaggtgtctcgcctcaagcacgaactcgacgtcgagagacgc
tctgccgccgacaaaatcatcgaacttgagacccaactttcctctgcgaaggttgacacc
aacgaggaggtcaaccgactgaaggctgaactggaagcagagaggaacactactgccaat
aagatcatcgagctggaggctcttctctcttccgccaaggacagctccaacgatgaggtc
agccgtcttaaggatgaattggaggccgagaggaagactgcctctgacaagatcaccgag
ctcgagacccaggtctcttccgcaaaggacggccccaacgacgaagtcgtcgctctcaag
gctgaggccgagaagtaccaaaagcagcttcaagaggaacgcgagactctcaccaacacc
atcgaatcccttgagaagcagatttctgacctcaaggctgaggtgactgaggccaccgag
aagcacgccgctgcactcagcggggagcgggagacctcggctgctgccattgttgccatt
gaggagaagcttgttgcagccgagaaggaccacgctgagaagctccgcatgcttgaggag
aacctcaagaaccatgaggaggagcgtggtgctctcaagacccagtctgaactcgacgaa
cttctcgagcaagccaagaaagacgctgatgagaaggtcgctgctgttgaggctgaggcg
aagaagcttcaggaggatctccagaagcaccaggaggaccttcaaaagcacgaggaggag
cggagcactctcaagtctcaacatgagatcgaggagattgtcgagcaggtcaagaaggag
gctgctgagaagctggctgccgctgaggcagagaagctgaagctgcaggaggatctgcag
aagctcggcgaggaacgtggcgctcttaagtcccagactgaacttgatgagctcgttgag
caagtcaagaaggatgctgcagagaagatcgctgctgccgaggctgagtccaagaagctt
caggaggaccttgagaaggagaagtccgagactgctgcttacgaggagaagatggctact
atcgagcgtgaggcttccgagcgtgctcagaagatcctagacgactacaaccaagctcag
aacgccctcagcaaggccaaggaagacaacgagaacctgactacccagcttgatgccttc
caggagacagtcaaggctgcccaagacagcatctccgacaaggccaaccagttcgaggag
cttcagaagcagtacgagcagtctaagcagcgcaccgccgagctcgacaacactatggat
gaagttcgccagaaggcttacgaagacctggagcatgccaagtccgagagcaaggctttc
gccgacaaactcaaggatttggaagatgagagcgctgaggctaaccgccgcatggaagcc
caacgtgctgcttacgaggttctaaaggccgagcacgccaacgtctcctccgagtctgag
gaacgtctccagaagcgcatccaggagcttgagcatgaaagcctcaaggccgccgaagag
gccgctgctcaccaagagaagattgccgcaatcgagaaggaaatggccgaaaggctcgag
cgtgagcaagagaccctcaagaagcaactcgccgagttggacgagaagcgtgccgctatg
gataccgagaaggaggcgatgcagtccatcaccacccagctgcaagacaaggtcgccgag
cttgagaaggaggccgccgagaaggcccgcctcgtcgaagacagctccaacaacctcaag
aggcaaagcgtcgagtacgacagtgacaaggcctcccttcagtctgccatcgagtccctc
caggacaagatccggggtctggagcaagagcgctctgagactgagaccgttgccagcgtt
gaggtcgaaaagctgaagaagcaaatcgccgacttcgagcaggagaagggctctgcagac
tcaatcattgcggctctgcaagacaaggttactgttctgcagcaggagaaggccgacggt
tctcgtggcgccgatgatgattctgagaagctcaaccagcgcatccaggagcttgagatg
gacaaggcttcgatggagtcgacaatcacggctctgcaagacaaggtcatcggcctacag
caggatacctccgacaagagctctgatcttgttgctgaggttgagaggcttaggcaagaa
tgctcggagcttgagcaggagaaggccgagatggtccgccgcgcccaggatgcggctcag
agcaacgccatcgccactgagaagcaccaggacgattacaacttcctcctccagcgcctc
gagaggtccacccaggaacatgctgctgttgtcgagcagcttcaggatgactacactctt
ggtctccagaagatcgctgattctgctcgcatcaagaccaggaagcagagcctccacagc
ctgactgatgagattgttcagctcatcaccgacaaggcccacctcgaggatgaccttgag
gcgagggacggtgctcttcagaacgccagggaaaccgtcaaggatctgcgcgagaagatg
agtggcgagcaccaaggcgagatcgctcacgacgagatcatgtcgaaccttcagaaccgg
atcaaggagcttgagcagcagcgctcggacgaggtggatggcctgactagtgagctggag
tccaagactcaccagatcaccgagctttgcaccagaatcgagacggtcgccgaggagctc
gatgccaagaagactgagacccaggatgctctcgctaccatcgacttccaccagcgcgcc
accaaggctgtccaggctgagtacgaggagcaggtccaggagattgttcgtgtctacaac
gtgcagcttgaggagagcgcccagactctgcagggccgtgaccacgaaatcgaaagtctt
cgtcaaaccattgacaacttgcatcttgagctcgaggaggctgtcaagggccccaacgtc
ttcgaggtccgtcaggagtttgaagaccgcaccaggaagctcgagggtcgcattaatggc
ctcactgaggagaaggatgtccttgagaagcagctcttcgctgcgcgtcaagccaacgag
gaggacgcggacaagattcctcagctgcacgaggagctcgatagactccacgaggagatc
gaggaacttcagagtgcgcttgaggaggctgagcgccagctgaatgatgcccacgatagg
ctgaagggcgttgacaaggagcattctaaggtgatcaagtccctccaagacaagattgcg
gacgccgaatacaaaatggccgacaagatcgcggagaaggatgccgagatgtcccgcatg
aaccaggaacttgctgcccgtcgccagtccattgacgaggccatgcctcagctcgatgac
tacagggccatgaagcgcgacctcgacgagaagaccatggagcttgaggagaagtctcgc
caagtcgatggtctcatgcagaccttgagggctcttgatgaagctcacgaggaacgcgat
ggccaccacgcctctggtctcgagaagatgaagcgcgagcttgagtctgagcttgcccgt
gttcgtgtcgagttggagaacgagatcgtcaggctcaagacgctcaaccaacagttgacc
gaggcgaacgagaggctcgagcatgagaagaccggaaaggaggctctcttgaagcagaag
ctggcagagctcgagcagctcaagaaggaggccgaggaaagccgcactgagcacgaccag
ctgctcgagaagctgtggtcggagcacgccaaggagcgttcctcgatggagcagaccctg
gaacagatctacgagcaagagaaggctgccatcgagcagaatttcaagcacgagcactcg
accatgaaggagtcgctcgaggcagagatcgctcgtgtcaagaaacagcatgacgagact
gacaagctgtaccagcaagcgctcgaggaggcactcaaggaggagagggcgaagcttcat
atggaggctgcatctcgtgaggagcaaatcaaggccgaaatgaagaagactgagcaagta
accgtccagaagctcactgacctactcgacgtcgccaaggccgagatcaacgaccagttc
tccgagatcaagcgcgccgaggccgaaatcgatcgtctcaacaccgagattgacaagctc
catgtcgaaattgccggcacccgcgagagccctcgtgtcgctgagctcatccgtgagtgc
gagacatacaagcagcgtcttatcgaactcgagaccgaactcgcctcctaccgtcagaat
ggtggcgctcctccgcagtaccggaactctggcgaggaggagagggataacttgaacgat
aagtcggctagcggccagatggctggtatccgtgaacaagttcgtcagctgggtcagctc
aacgatgagttgatttcgcacaaccaagacgtctcgggcttcatccgtaatggcttcggt
actccgaggaagcagtccgtcaacatcgaggcttcgcccgccgattcataa

DBGET integrated database retrieval system