KEGG   Neofusicoccum parvum: UCRNP2_6342Help
Entry
UCRNP2_6342       CDS       T03126                                 

Definition
(RefSeq) putative alpha-ketoglutarate dehydrogenase complex subunit protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
npa  Neofusicoccum parvum
Pathway
npa00020  Citrate cycle (TCA cycle)
npa00310  Lysine degradation
npa00380  Tryptophan metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
npa01130  Biosynthesis of antibiotics
npa01200  Carbon metabolism
Module
npa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRNP2_6342
  09105 Amino acid metabolism
   00310 Lysine degradation
    UCRNP2_6342
   00380 Tryptophan metabolism
    UCRNP2_6342
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UCRNP2_6342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N baeRF_family12
Motif
Other DBs
NCBI-GeneID: 19025827
NCBI-ProteinID: XP_007585607
UniProt: R1EHC6
LinkDB All DBs
Position
Unknown
AA seq 1048 aa AA seqDB search
MLRTTLRQCSSRLVTGSSAARTPFSPSASALASKRRALAITAQRLQTRRYAVSAEDTSRG
VDPSDSFLQGNTANYVDEMYMQWKRDPQSVHVSWQVYFRNMEEGDMPVSQAFQPPPTIVP
NPVGGVPAFATPGLGMAAGEGSDVMNHLKVQLLVRAYQARGHHKAKIDPLGIRGEAAQFG
YSKPKELELEHYNFSEKDLDQEFTLGPGILPRFKTDGREKMTLREIIATCERLYCGSYGV
EYIHIPDREQCDWLRQRIEVPQPYKYSVDEKRRILDRLIWGTSFESFLATKYPNDKRFGL
EGGESLIPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTADPS
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAILHYNNDEQEA
KTAMGVLLHGDAAFAGQGVVYETMGFHALPKYHTGGTIHIIVNNQIGFTTDPRFARSTPY
CSDIAKAIDAPVFHVNGDDAEAFNFVCQLAADYRATFKKDVVIDMVCYRKQGHNETDQPF
FTQPLMYKRIAEQKPALDKYVDKLLQEGTFTKEDVDEHKAWVWGMLEESFSRSKDYQPTA
KEWLTSAWNGFKSPKELATEVLPHLPTAVDAEVLKQVAEKIGGSPEGFTVHRNLKRILQN
RTKTVTEGKNIDMATAEALAFGTLCLEGHHVRVSGQDVERGTFSQRHAVLHDQENEGTYT
PLASLSQDQGSFVISNSSLSEFGVLGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQF
IASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLERQHQD
CNMQIAYLTKPSNMFHILRRQMNRQFRKPLVLFFSKSLLRHPMARSDIDEFTDDSHFQWL
VPDPAHETNEIAPKDEIERVVICTGQVWGALWQYRQEHGLKNTAITRIEQLHPFPWAQLR
DNLDSYPNAKNIVWCQEEPLNAGAWSFTQPRIETLLNETEHHNRRHVMYAGRNPSASVAT
GLKAVHKKEEKDLLEAAFTVTQDKLKGE
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcactaccctccgccaatgcagctcccgcctggtgacgggtagctctgctgcg
cggacgcccttctcgccctccgccagcgcgctggcatcaaaacggcgcgccctcgccatc
accgcccagcgcctgcagacgcgccgctatgccgtctccgccgaggacaccagccggggc
gtggaccccagcgactccttcctccagggcaacaccgccaactatgtcgacgagatgtac
atgcagtggaagcgcgatccgcagagcgtgcacgtctcgtggcaggtctacttccgcaac
atggaggagggcgacatgcccgtctcgcaggccttccagcccccgcccaccatcgtcccg
aaccccgttggcggcgtgcccgccttcgccactcccggcctcggcatggccgccggtgag
ggctctgatgtcatgaaccatttgaaggtccagctgctcgtgcgtgcctaccaggctcgc
ggccaccacaaggcgaagatcgacccgcttggcatccgtggcgaggccgcgcagtttgga
tacagcaagccgaaggagctggagctggagcactacaacttctcggagaaggatttggac
caggagttcaccctgggccccggcattctgccgcgcttcaagaccgatggtcgcgagaag
atgaccctccgtgagatcattgccacctgcgagaggctctactgcggctcgtacggcgtc
gagtacatccacatccccgacagggagcagtgcgactggctgcgccagcgcatcgaggtc
ccccagccctacaagtactcggtcgacgagaagcgtaggattcttgaccgtttgatctgg
ggtaccagcttcgagtccttcctcgccaccaagtaccccaacgacaagcgtttcggcctg
gagggtggcgagagcttgattcccggcatgaaggctctgatcgaccgcagcgtggattat
ggagtcaaggacattgtgattggcatgcctcatcgtggtcgtctcaacgtgctcagtaac
gtcgttcgtaagcctaacgagtccatcttctccgagttcgccggcaccgccgacccctcc
gatgagggctccggtgacgtcaagtaccacttgggtatgaacttcgagcgtcccactcct
tccggcaagcgtgtccagctgtctctcgttgccaacccctcccacttggaggccgaggac
cccgttgtcttgggtaagactcgtgctatcctccactacaacaacgatgagcaggaggcc
aagaccgccatgggtgtcctgctccacggtgacgctgccttcgctggccagggtgttgtg
tacgagaccatgggcttccacgctctgcccaagtaccacaccggtggcaccatccacatc
atcgtcaacaaccagattggtttcaccacggatcctcgcttcgcccgctctactccctac
tgttccgacatcgccaaggccatcgatgcgccggttttccacgtcaacggtgacgatgcc
gaggccttcaactttgtctgccagctcgccgccgactaccgcgccaccttcaagaaggat
gtcgttatcgacatggtctgctaccgcaagcagggacacaacgagaccgaccagcctttc
ttcacccagcctcttatgtacaagcgtatcgcggagcagaagccggccctcgacaagtac
gttgacaagcttctccaggagggcaccttcaccaaggaggacgttgatgagcacaaggct
tgggtgtggggcatgctcgaggagagcttctcccgcagcaaggactaccagcccacggcc
aaggaatggttgacgtctgcttggaatggcttcaagtcccccaaggagcttgccactgag
gttcttccccacctgcctactgccgtcgacgccgaggttttgaagcaggttgctgagaag
atcggtggctcccccgagggcttcaccgttcaccgcaacctcaagcgtattctgcagaac
cgcaccaagactgtcaccgagggcaagaacatcgacatggctaccgctgaggcgctcgcc
ttcggaactctctgcttggaaggccaccatgtccgcgtgtctggtcaggatgtcgagcgt
ggtaccttctctcagcgccacgctgtcctccacgaccaggagaacgagggcacctacact
cctctggcaagcctcagccaagaccaaggctccttcgttatctccaactcctcgctgagc
gagttcggagtccttggttttgaatacggatactctctttcgtccccgaacgccctggtc
atgtgggaggcgcagttcggtgacttcgccaacaacgctcagtgcatcattgaccagttc
atcgcttccggcgaggttaagtggctgcagcgtagcggcctcgtcatgtcgcttcctcac
ggttacgatggccaaggtcctgagcactcttccggccgcatggagcgctacctccagctt
tgcaacgaggatccccgcatcttccccagcccggacaagctcgagcgccagcaccaggac
tgcaacatgcagatcgcctacctcaccaagccttccaacatgttccacatcctccgtcgc
cagatgaaccgccagttccgcaagcctctcgtcctcttcttctcgaagtctctcctccgt
cacccgatggcccgctcagacattgatgagttcacggatgactcgcacttccagtggctc
gttcccgacccggctcatgagacgaacgagatcgcgcccaaggatgaaatcgagcgcgtc
gtcatctgcactggtcaggtgtggggtgctttgtggcagtaccgccaggagcacggactg
aagaacactgccatcacgcgcattgagcagcttcaccccttcccgtgggcgcagctcagg
gacaacctcgactcgtaccccaacgccaagaacattgtgtggtgccaggaggagcccctg
aacgcaggtgcctggtcgttcacgcagccgcgcattgagactctcctcaacgagacggag
caccacaaccgcaggcacgtcatgtatgccggacgcaacccgagcgccagtgttgccacg
ggtctgaaggcggtgcacaagaaggaggagaaggatttgttggaagcggccttcacggtc
acgcaggacaagctgaagggcgagtaa

DBGET integrated database retrieval system