KEGG   Neofusicoccum parvum: UCRNP2_6376Help
Entry
UCRNP2_6376       CDS       T03126                                 

Definition
(GenBank) putative camp-dependent protein kinase catalytic subunit 1 protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
npa  Neofusicoccum parvum
Pathway
npa04113  Meiosis - yeast
npa04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:npa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    UCRNP2_6376
  09143 Cell growth and death
   04113 Meiosis - yeast
    UCRNP2_6376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npa01001]
    UCRNP2_6376
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:npa03019]
    UCRNP2_6376
   03036 Chromosome and associated proteins [BR:npa03036]
    UCRNP2_6376
Enzymes [BR:npa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     UCRNP2_6376
Protein kinases [BR:npa01001]
 Serine/threonine kinases: AGC group
  PKA family
   UCRNP2_6376
Messenger RNA biogenesis [BR:npa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     UCRNP2_6376
Chromosome and associated proteins [BR:npa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    UCRNP2_6376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-ProteinID: EOD46893
UniProt: R1EGI5
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MPTLGFLKKKRTKDSSGSRDLDSPSSPVKEKDTPSTVTPTVSKSGSDQAHQPPLSPPSSH
TSGHAPQDSLTQNTRPAEPMNSQPYSQQYATPQPSSQSPQPYSPQPQQSHNLPSIQNLIN
PANGADASRSFNNAQDKTMAQNGSAVTPSGGQASATPSVRTTKGKYTLNDFSIQRTLGTG
SFGRVHLVQSKHNQRFYAIKVLKKAQVVKMKQVEHTNDERRMLQKVKHPFLITLWGTFQD
SKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALDYLHSQDIIYRDLKPENL
LLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEML
CGFTPFWDGGSPMKIYENILKGRVKYPPYVHPDAQDLLQKLITPDLTKRLGNLHGGSKDV
MNHPWFAEVTWERLAKKDIDAPYVPPVRAGAGDASQFDKYPEETEAYGASGDDPHGSLFS
EF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccgactctcggattcctgaagaagaagcggacgaaggactcgtcaggttcgcgcgac
ctcgactcgccgtcgtcgcccgtcaaggaaaaggacaccccgtcgaccgttacccccacc
gtctccaagagcggctccgaccaggcacaccagccgcccttatcgcccccctcctctcac
acctccggccacgctccccaggactcgctgacgcagaacacgcgccccgccgaacctatg
aactcgcaaccctactcgcagcagtacgcgaccccgcagcccagctcccaaagcccccag
ccgtactcgccgcagccgcagcagagccacaacctccctagcatacagaatctcatcaac
cccgccaacggcgccgacgcgtcgcgctccttcaacaatgcccaggacaagacaatggcc
caaaacggaagcgctgtgaccccctcgggcggtcaggcgtcggcaacgccctcggttcgc
accaccaagggcaagtacacgctcaatgacttctccatacaacgaactctcggcaccggc
tcctttggtcgcgtgcacctcgtgcagtccaagcacaaccagcgcttctacgccatcaag
gtcctgaagaaggcccaggtcgtcaagatgaagcaggtcgagcacacaaacgacgagcgc
cgcatgctgcagaaggtcaagcaccccttcctcatcacgctgtggggcactttccaggac
tccaagaatctgtacatggtgatggacttcgtcgagggtggtgagctgttcagtctgctg
cgaaagtcacagcggtttcccaatcccgtcgctaagttctacgccgccgaggtgacactt
gcgctcgactatctccactcgcaggacatcatctaccgcgacctgaagcccgaaaacctg
ctgctggaccgccacggccatctcaagatcacggacttcggttttgcaaaggaggtgcct
gatatcacctggacgctctgcggtacaccggactatcttgcgccggaagtggttgcatcg
aagggttacaataaatctgttgactggtggtcgctcggaattctgattttcgaaatgctt
tgcgggttcactccgttctgggatggagggtcgccgatgaagatctacgagaacattctg
aaaggccgcgtcaagtacccgccatacgtgcacccggacgcgcaagatttgctgcagaag
ctcatcacccctgatctcaccaagcgcctgggtaacctgcacgggggctcgaaggatgtc
atgaaccacccgtggttcgcggaagtcacctgggagcgattggccaagaaggacattgac
gcgccgtacgtcccgcctgtccgagcaggcgccggtgatgcgagtcaattcgacaagtat
cccgaagagactgaggcttacggagcatccggcgacgacccacatggatctttgttttcg
gagttttag

DBGET integrated database retrieval system