KEGG   Neofusicoccum parvum: UCRNP2_6446Help
Entry
UCRNP2_6446       CDS       T03126                                 

Definition
(RefSeq) putative glycogen synthase protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
npa  Neofusicoccum parvum
Pathway
npa00500  Starch and sucrose metabolism
npa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRNP2_6446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:npa01003]
    UCRNP2_6446
Enzymes [BR:npa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     UCRNP2_6446
Glycosyltransferases [BR:npa01003]
 Polysaccharide
  Storage polysaccharide
   UCRNP2_6446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5 DUF759
Motif
Other DBs
NCBI-GeneID: 19025942
NCBI-ProteinID: XP_007585711
UniProt: R1EGA7
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MGEPRDVTNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGAAYTLLGPLNRTSAQVEV
EELEPKDPALAQTIKNMNDRGIVTLYGRWLIDGAPRVLLFDTGTAYKFLDEWKGDLWSVA
GIPSPPGDGETNEAIVFGYLIAWFLGEYVFHEKKRAVVAQFHEWLAGVALPLCKKRRIDV
TTIFTTHATLLGRYLCAGSVDFYNNLQFFDVDAEAGKRGIYHRYCIERGAAHSADVFTTV
SHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKTKINDFVRGHFYGHNDF
DPENTLYFFTAGRYEYRNKGVDMFIESLARLNHRMKSAGSTVTVVAFIIMPAQTQSLTVE
ALKGQAVIKSLHDTVDVISKNVGKKLFERSLAWHEGMELPEDKELISAADKIMLRRRLFA
MKRHTLPPIVTHNMVNDHDDPVLNQIRRCQLFNHPTDRVKVVFHPEFLNSANPVLPMDYD
DFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYIVD
RRMKGVDDSVNQLSDYMFEFTKKSKRQRINQRNRTERLSDLLDWKRMGMEYVKARQLALR
RAYPDAFDGGDEPDFFGNAEVKISRPLSEPGSPRDRSEDYIAWRLPEEEEPEDYPFPLTL
KTKKLSDSPALNGS
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaccgagagacgtcacgaaccacgtccttttcgaggtcgccaccgaggttgcc
aatcgagtgggcggcatttattcggtcctcaagtccaaggcgcaggtcacgacagcagag
tatggcgccgcttacacgcttctcggcccactcaatcgcacatcggcccaggtcgaggtc
gaagagcttgagcccaaagacccggctctggctcagacgataaagaacatgaacgaccgg
ggcattgtcacgctctatggtcgctggctgatcgatggcgcgccgagggtccttctcttc
gacaccggcactgcctacaagttccttgacgagtggaaaggtgatttgtggtccgttgcc
ggcatcccttcgccgccgggcgatggcgagaccaatgaggccatcgtctttggctatctt
atcgcatggttcctgggagagtacgtcttccacgagaagaaacgcgcggtcgttgctcaa
tttcacgaatggctcgctggtgtggctcttcctctctgcaagaagagacgcatcgatgtc
actaccattttcaccacgcacgccaccctcctcgggcgctacctctgcgccggctccgtc
gatttctacaacaacctgcagtttttcgatgtggatgcagaggcaggcaagcgcggtatt
taccacaggtattgcattgagaggggcgcggcacactcggcagatgtcttcacgacagtc
tcgcatatcactgcctacgagagtgagcaccttttgaagcgcaagccggacggcgtatta
ccgaacggtctcaacgtcaagaagttctctgcaacgcacgagttccagaacctgcatcag
caagccaagacgaagatcaacgactttgttcgcggtcacttctacggtcacaacgatttc
gacccggagaacacgctttacttcttcactgcaggtcggtatgaataccggaataagggt
gtagacatgttcatcgagtcgttggcccgtctgaatcaccgcatgaagagcgcgggctcg
accgtaactgtggtagcattcatcatcatgccagctcagacacagtctttgacggtggaa
gcgctgaaaggccaggcggtcatcaagtccctgcatgatacagtcgacgtcatttcgaag
aacgtgggaaagaagctgtttgagagatcactcgcatggcacgagggtatggagctcccg
gaggacaaggagctcatctcggcagcggacaagatcatgctccgcaggcggctgtttgcc
atgaagcgccacactctcccacccatcgtcacgcacaacatggtcaatgaccacgacgat
ccagtcctgaaccagattcgcaggtgtcagctcttcaaccaccccacagatagggtcaag
gttgtgttccatccggaattcctaaattcggcgaacccggtgctacccatggattacgat
gacttcgttcgtggcactcatcttggtgtattctcgtcttactacgagccgtggggttac
acccccgcagagtgcaccgttatgggtgttccgagcatcacgacgaacttgtccgggttc
ggttgttacatggaggagctgatcgagaacgcgcaggactacggtatctacatcgtcgac
aggcggatgaagggagttgatgactcggtcaaccagctctcggattacatgttcgagttc
acgaagaagagcaagcgccagcgtatcaaccagcgtaaccggacggagagattgagcgat
ctgcttgactggaagaggatgggtatggagtacgtcaaggcccgccagttggccttgcgg
agagcctatcctgacgcttttgacggtggcgacgagcctgacttctttggcaatgccgag
gtcaagatctctcgtccgctctcagagcctgggtcccctagggatcggtcagaggactac
attgcctggaggctacctgaggaggaggagcccgaggactacccgttccctctgacgctg
aagacgaagaaattgtctgactctcccgcactcaacggctcataa

DBGET integrated database retrieval system