KEGG   Neofusicoccum parvum: UCRNP2_8323Help
Entry
UCRNP2_8323       CDS       T03126                                 

Definition
(RefSeq) putative glutamate decarboxylase protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
npa  Neofusicoccum parvum
Pathway
npa00250  Alanine, aspartate and glutamate metabolism
npa00410  beta-Alanine metabolism
npa00430  Taurine and hypotaurine metabolism
npa00650  Butanoate metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
Module
npa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UCRNP2_8323
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_8323
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCRNP2_8323
   00430 Taurine and hypotaurine metabolism
    UCRNP2_8323
Enzymes [BR:npa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCRNP2_8323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 19028003
NCBI-ProteinID: XP_007587565
UniProt: R1G9X0
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MVHLARVPTDLEASLPVIEGLEKLKLEEYIEPDTITASVYGSRFAIEDIPRHEMPEREMP
KEIAYRLIKDDLSLDGTPTLNLASFVTTYMEEEAEKLMMDAFAKNFIDYEEYPVSADIQN
RCVSMIARLFNIPSADENTNAMGTSTIGSSEAIMLAVLAMKKRWANRRKAEGKPFDKPNI
VMNSAVQVCWEKAARYFDVEEKYVYCTADRYVIDPVEAVDLVDENTIGICAILGTTYTGE
YEDIKEINDLLEENEIDCPIHVDAASGGFVAPFVKPDLVWDFRLPKVASINVSGHKYGLV
YPGVGWVVWRDPEYLPKELIFNINYLGADQASFTLNFSRGASQIIGQYYQLIRLGKHGYR
SIMTNLTRTADYLAANLRALGFIIMSEGEGNGLPLVACRLDPERKKHYDEFAIAHQLRER
GWVVPAYTMAPHSEKLKLMRVVVREDFSRSRCDALIQDFKLALEVLDKMEPKRVEEHKEH
VKNHASKIGRRRTMTNTHFKDEEHSLQGKEGKTHAVC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtccaccttgcccgcgtccccaccgacctcgaggcctcgctgcccgtcatcgagggc
ctcgagaagctcaagctcgaggagtacatcgagcccgacaccatcaccgcctccgtctat
ggctcgcgcttcgccatcgaggacatcccccgccacgagatgcccgagcgcgagatgccc
aaggaaattgcctaccggctgatcaaagacgacctgtcgctcgatggcacgcccacgctc
aacctcgcctcgttcgtcaccacgtacatggaggaggaggccgagaagctcatgatggac
gccttcgccaagaacttcatcgactacgaggagtaccctgtctcggccgacatccagaac
cgctgcgtgtccatgattgcccgcctgttcaacatcccgtcggcggatgagaacaccaat
gccatgggcaccagcaccattggctcgtccgaggccattatgctggccgtgctcgccatg
aagaagcgctgggcgaatcggcgcaaggccgagggcaagccgttcgacaagcccaacatc
gtcatgaactccgccgtccaggtgtgctgggagaaggccgcccgctacttcgacgtcgag
gagaagtatgtctactgcaccgcagaccgctacgtcatcgatccggtcgaggcggtcgac
ctcgtcgacgagaacaccatcggcatctgcgccatcttgggcaccacatacaccggcgag
tacgaggacatcaaggagatcaacgacctgctggaggagaacgagatcgactgccccatc
cacgttgatgctgccagcggcggcttcgttgccccgttcgtcaagcctgacttggtctgg
gacttccgcctgcccaaggtcgcgagcatcaacgtttccggccacaagtacggcctcgtc
tacccgggtgttggctgggttgtctggcgtgaccctgagtacctgcccaaggagctgatc
ttcaacatcaactacctgggcgcggaccaggcttcgttcacgctcaacttctcgcgcgga
gcgtcccagatcatcggccagtactaccagttgatcagactgggaaagcacggctaccgc
tccatcatgacgaacctcacccgcaccgcggattatctggcggccaacctgcgggctctc
ggctttatcatcatgtccgagggagagggcaacggtctgccactggttgcatgccggctc
gacccggagaggaagaagcactacgacgagttcgcgattgcccaccagcttcgcgagcgc
ggttgggtggtgccggcgtacacgatggcgccgcacagcgagaagctcaagctgatgcgc
gtggtggtgcgagaagacttctcgcgcagccggtgcgacgctctgatccaggacttcaag
ctggcgctggaggtcctggacaagatggagccgaagagggtcgaggagcacaaggagcat
gtcaagaaccatgcgtccaagattgggcgtcgcaggacgatgaccaacacgcacttcaag
gacgaggagcactcgctgcaaggcaaggagggcaagacacacgcggtgtgctag

DBGET integrated database retrieval system