KEGG   Neofusicoccum parvum: UCRNP2_938Help
Entry
UCRNP2_938        CDS       T03126                                 

Definition
(RefSeq) putative glutamate decarboxylase 1 protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
npa  Neofusicoccum parvum
Pathway
npa00250  Alanine, aspartate and glutamate metabolism
npa00410  beta-Alanine metabolism
npa00430  Taurine and hypotaurine metabolism
npa00650  Butanoate metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
Module
npa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:npa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UCRNP2_938
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_938
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCRNP2_938
   00430 Taurine and hypotaurine metabolism
    UCRNP2_938
Enzymes [BR:npa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCRNP2_938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 AbiEi_4 SepSecS
Motif
Other DBs
NCBI-GeneID: 19029168
NCBI-ProteinID: XP_007580263
UniProt: R1H1G9
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MATNGAANGTVHPQPVDALPSRADEVAELLDAVQKLLIPFIRAADEDAATKPTGRGLTVD
GSSEPRTVLVESHPPKKLESILNLQLPEHGVGKEGLLEVVQRILQYSVNTWDQGFMDKLY
ASTNAVHVYQVSPALTLIEKHTTKQLATLFGFTGPYAGGISQPGGSASNATSVVVARNTL
YPETKTEGIHGSPRRFVLFTSAHGHYSLEKAAQMFGFGSSAVRTVPVDAAGRMDPAALES
LVVAAKDAGETPFYVNATAGTTVLGSFDPIDAIADVCAAHGLWLHVDGSWGGPVAFNADI
RASRLRGVERADSVAVTPHKMLGVPLTCSFLLARDLRRVRAAMTLPAGYLFHNDGGDDDT
NDLYDLADLTPQCGRKGEALKLFLAWLSQGSAGFAARIAAAFARAELLHARLRASEHVQL
VSQSPLPCLQVCFYYAPRGALSPDPAVNSGRTEEMARRLVRRGWMVDFAPGERGKFFRVV
VNGETREGTVEGLVRAVEEVGAEVVGEEAA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaacggcgccgccaatggcaccgtccacccccagccggtcgacgcactgccc
tcgagggctgacgaagttgccgagctgctcgacgccgtgcagaaactgctgatcccgttc
atccgcgccgccgacgaggatgccgccaccaagcccaccggccgtggtctgaccgtggac
ggcagcagcgagccgcgcaccgtgctggtcgaatcgcacccgccgaaaaagctcgagtcg
atcctcaatttgcaattgcccgagcatggcgtggggaaggaggggttgctggaggttgtg
caacgcattcttcaatactcggtcaacacgtgggaccagggcttcatggacaaactatat
gcttccaccaatgctgtccacgtctaccaagtctccccggccctcactctcatcgagaag
cacaccaccaagcaactcgccacgctgttcggcttcacagggccctacgcgggcggcata
tcgcagcccggcggctcggcctccaacgccacctcagtcgtcgtcgcgcgcaacacgctc
tacccggaaaccaagaccgagggcatccacggctccccccgccgcttcgtcctcttcacc
tccgcgcacggccactacagcctcgagaaggcggcgcagatgttcggcttcggcagctcc
gccgtgcgcaccgtccccgtcgacgccgccggccgcatggacccagccgcgctcgaatcg
ctcgtcgtcgcggccaaggacgcgggcgagacgcccttctacgtcaacgcgaccgccggc
accaccgtgctcggcagcttcgacccaatcgacgccatcgcggacgtgtgcgcggcgcac
ggcctctggctgcacgtcgacggctcctggggcgggccggtcgccttcaacgccgacatc
cgcgcgtcgcggctgcgcggggtcgagcgcgccgactcggtcgccgtcacgccgcacaag
atgctgggcgtgccgctgacgtgctccttcctgctggcgcgcgacctgcggcgcgtgcgc
gcggccatgacgctgccggccggctacctcttccacaacgacggcggcgacgacgacacc
aacgacctgtacgacctcgccgacctgacgccccagtgcggccgcaagggcgaggccctc
aagctgttcctggcctggctgagccagggctccgccggcttcgccgcccgcatcgccgcc
gccttcgcccgcgccgagctgctgcacgcccgcctgcgcgcgagcgagcacgtccagctc
gtcagccagagccccctgccgtgcctgcaggtgtgcttctactacgccccgcgcggcgcg
ctcagccccgacccggccgtcaacagcgggcgcaccgaggagatggcgaggcggctggtg
cggaggggctggatggtggacttcgcgccgggggagcgcggtaagttcttcagggtcgtg
gtgaacggcgagacgagggaggggactgtggaggggttggtgagggccgtggaggaggtc
ggggccgaggttgtgggcgaggaggcggcttga

DBGET integrated database retrieval system