KEGG   Natrinema pellirubrum: Natpe_1241Help
Entry
Natpe_1241        CDS       T02425                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
npe  Natrinema pellirubrum
Pathway
npe00564  Glycerophospholipid metabolism
npe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Natpe_1241
Enzymes [BR:npe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Natpe_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox NAD_binding_8 NAD_binding_7 3HCDH_N HI0933_like Pyr_redox_3 ApbA GIDA TrkA_N PALP Sacchrp_dh_NADP Thi4 K_oxygenase Shikimate_DH NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGB31146
UniProt: L0JLA3
LinkDB All DBs
Position
1209857..1211074
Genome map
AA seq 405 aa AA seqDB search
MERTEVLVIGGGATGAGIARDLARRGVDVTLVERDGLASGTSGRSHGLLHSGARYAEADG
PEAQACLEENRIVRRIAGECVRDTGGLFVELAADDPAYFEAKRAACENVGIPTDVVDGAA
AREAVPGLATDVERAMEVPDGVVVPSRLVAANAADARDHGARIRPHTPVTSMTTEDGRIR
SVTLGGDADATLSPEYVVNATGPHAGRVAAMAGAAVEMRPTRGVMVSVEYPGLEPVLNRC
REPADGDIVVPHDGEVVLGTTSVAVDDPDDYERADWEITATVRECAAMLPPVADADHVRT
WWGVRPLYEPDEATRGGRGISRGFHLLDHAEAGVENCCSIVGGKLTTYRRMAEATADLVC
ERLEVDADCSTGDERLPAASDPDRLDEFVREFDGQGPTDADLVGS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaccgaagtcctcgtgatcggcggcggcgcgaccggggcgggaatcgcaaga
gacctcgcacgcaggggcgtcgacgtcacgctcgtcgagcgcgacgggctcgcgtcgggt
acctcgggccggtcgcacggtctgttgcacagcggcgcacgctacgcagaggccgacggg
ccggaggcccaggcgtgtctcgaggagaaccggatcgtccgccggatcgcgggcgagtgc
gttcgggacaccggcggactcttcgtggaactcgcggccgatgatccggcgtacttcgag
gcgaagcgagcggcctgtgagaacgtcggtatcccgaccgacgtcgtcgacggcgcggcc
gcccgcgaagcggtcccgggactggcgaccgacgtcgaacgcgcaatggaggtcccggac
ggggtcgtcgtcccgtccagactggtcgcggcgaacgcggccgatgcccgcgaccacggc
gcgcgaatccgcccgcacacaccggtcacgtcgatgacgaccgaggacggccgaatcagg
tccgtcacgctcggcggcgacgccgacgcgacgctcagtccggaatacgtcgtgaacgca
accgggccccacgccggtcgggtcgcggcgatggccggcgctgccgtcgagatgcgaccg
actcgcggcgtcatggtctcggtcgaatatccgggcctcgagccggttctcaaccggtgt
cgcgagccggccgacggggatatcgtcgtccctcacgacggcgaggtcgtcctcgggacg
acgagcgtggcggtcgacgatccggacgactacgagcgggccgactgggagatcacagcg
acggtccgggagtgtgcggcgatgctcccgccggtggccgatgccgaccacgtccggacg
tggtggggggtccgcccgctgtacgaacccgacgaagccacgcggggtgggcgcggcatc
tcgcgtggcttccacctgctcgatcacgccgaggcgggcgtcgagaactgctgtagcatc
gtcggtgggaagctgacgacctatcggcggatggccgaggcgaccgcggacctcgtctgc
gagcgactcgaggtcgacgcggactgttccaccggggacgagcggctgccggcggcgtcc
gatcccgaccggctcgacgagttcgtccgggagttcgacggacagggaccgacggacgcg
gatctcgtcggaagctaa

DBGET integrated database retrieval system