KEGG   Natronomonas pharaonis: NP_2770AHelp
Entry
NP_2770A          CDS       T00279                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nph  Natronomonas pharaonis
Pathway
nph00630  Glyoxylate and dicarboxylate metabolism
nph01100  Metabolic pathways
nph01120  Microbial metabolism in diverse environments
nph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NP_2770A (rbcL)
Enzymes [BR:nph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NP_2770A (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAI49476
UniProt: A0A1U7EWL2
LinkDB All DBs
Position
complement(1338816..1340069)
Genome map
AA seq 417 aa AA seqDB search
MEYADFLDESYEPSDDDLVCTFRLVPGEGISVADAAARVASESSNGTWAALSPESDVRQY
SALACDIGPEDEHGTQVTVAYPSGLFEDGSLPQILSCIAGNIMGMKAVETIRLLDCEWPA
VIARSFPGPQYGSDVRTELLDAGDRPPLATVPKPKVGLSTEEHVSVAESAWRGGVDLLKD
DENLTDQTFNPFEQRVADSFAARDRLEEETGERKDYLVNITAETDEMVRRAEFVDDHGGS
FVMVDIITCGWSGLQTVRRRTEDLDLAIHAHRAMHAAFDRLPQHGVSMRCLAQFARLAGV
DHIHTGTAGLGKLENEDTAGINEWLRSDLHGHSDVLPVASGGLHPGIVDQLLDALGTNVM
VQAGGGIHGHPDGTEAGARALRAAVDAYADGESLDSRAESVPALRTALDEWGTQNPR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgcagacttcctcgacgagtcgtacgaaccgtccgacgacgacctcgtctgt
acgttccggctggtgcccggcgagggcatctccgtcgccgatgccgccgccagagtcgct
tccgagagttcgaacgggacgtgggcggcgttgtctcccgagtccgatgtccggcagtac
tcggcgctggcctgcgatattggtcccgaagacgaacacggtacgcaggtaaccgttgca
tacccatcggggctcttcgaagacggcagcctaccgcagattctctcctgcatcgccggc
aacatcatggggatgaaagccgtcgaaaccatccggctgctcgattgtgagtggcccgcc
gtcatcgcccgctcgttccccggcccgcagtacggctccgatgtccggaccgagctgctc
gatgcgggcgaccggccgccgctggcgaccgttcccaagccgaaggtcggtctctcgacg
gaggagcatgtctcagtcgccgagtcggcgtggcgtggcggcgtcgacctcctgaaagac
gacgagaacctcaccgaccagacgttcaaccccttcgaacagcgggtcgcagactccttt
gccgcgcgtgaccgcctcgaagaagagaccggcgagcggaaggactacctcgtcaacatc
acggcagaaaccgacgagatggtccgtcgggcggagtttgttgatgaccacggcgggtcg
tttgtgatggttgatatcatcacctgcggctggagtgggctccagacggttcgccgtcgg
accgaggacctcgacctggcgattcacgcccaccgggcgatgcacgccgccttcgaccgg
ctcccccagcacggcgtctcgatgcgctgtctcgcgcagttcgcccggctggccggcgtc
gaccacattcacaccggtactgccggcctcggcaagctggaaaacgaggataccgccggc
atcaacgagtggctccgctcggacctccacggccacagcgacgtgctccccgtcgcctcg
ggcgggctccaccccggcatcgtcgaccaactgctggatgcgctcggaacgaacgtgatg
gtacaggccggtggcggtattcacggccatccggacggcaccgaggccggtgcgcgtgcg
ctgcgagcggccgtcgacgcctacgccgacggcgagagcctcgactcgcgcgccgagtcg
gtgccggcactccggacggcgctcgacgagtggggaacacaaaacccgcggtga

DBGET integrated database retrieval system