KEGG   Novosphingobium pentaromativorans: JI59_02015Help
Entry
JI59_02015        CDS       T03399                                 

Definition
(GenBank) glutathione S-transferase
Organism
npn  Novosphingobium pentaromativorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AIT78672
LinkDB All DBs
Position
complement(451591..452244)
Genome map
AA seq 217 aa AA seqDB search
MTAAPDPILYSFRRCPYAMRARLALMVSGTACELREVKLSAKPGAMLAASPKGTVPVLVT
AEGEVIDESIDIMRRSLAQNDPEGWLERDAPDLIARNDSTFKHDLDRYKYPERHGSDALA
HREAGLEVLLDLDARLAGKGQLCGAKRGLADMAIMPFIRQFAAVDRTWFDTLPLRHLKPW
LEAHLESDLFKAIMLRVKPWSPGDPIIRFAAPQRTAP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggcgcctgatccgatcctctacagtttccgccggtgcccctacgcgatgcgc
gcaaggctggcgctgatggtgagtggcaccgcctgcgaactgcgagaggtgaagctgtcg
gccaagcccggggcgatgctggccgcctcgccgaagggaacggtgcccgtactcgtcacc
gccgaaggcgaagtcatcgacgagagcatcgacatcatgcgccgatcgcttgctcagaac
gatcccgagggctggctggagcgcgatgccccggacctgatcgcccgcaacgacagtaca
ttcaagcacgaccttgaccgctacaagtaccctgagcgccatggctccgatgcccttgcc
caccgcgaggccggcctggaggtgctgctcgacctggacgcgcgccttgccgggaaaggc
cagctctgcggcgcaaaacgcggactggccgacatggcgatcatgccgttcatacgccag
ttcgcggccgtcgacaggacctggttcgataccttgccgctgcgacacctcaaaccgtgg
ctggaagcccacctcgaaagcgatctgttcaaggcgatcatgctgcgggtgaagccgtgg
tcgccgggcgatccgatcatccgcttcgcagcgccgcaacgcaccgccccataa

DBGET integrated database retrieval system