KEGG   Novosphingobium pentaromativorans: JI59_07605Help
Entry
JI59_07605        CDS       T03399                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    JI59_07605
Enzymes [BR:npn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     JI59_07605
Transporters [BR:npn02000]
 Other Transporters
  Pores ion channels [TC:1]
   JI59_07605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_N_4 GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AIT79658
LinkDB All DBs
Position
complement(1597227..1597898)
Genome map
AA seq 223 aa AA seqDB search
MWHIFQFPLCPFSRKVRLLMAEKGIAYELQSARPWENEDRLFAMNPAGRTPVIKETDRNI
VLCDSRAICEYFEETVDRNPLISGTAQQRAEIRRLIAMFDESFFNDVSGPLLHERMKKRL
VLRQSPDAKMLREAMKLAHDYLDYIDFLIDHRPWLAGSTMTLADLTAAAQISVADYLGGI
DWSSHEQSRGWYLVMKSRPSFRPLLSERMEVIQPPSHYAEVDA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacatcttccagtttccgctctgccccttcagccgcaaggtcaggctgctcatg
gcggaaaaaggcattgcctacgaactgcagtcggcccgcccctgggagaacgaagaccgc
ctcttcgcaatgaacccggccggacgcacgcccgtgatcaaggaaaccgatcgcaacatc
gtgctctgcgacagccgcgccatctgcgagtatttcgaggagacggtcgaccgtaatccg
ctaatcagcggcacggcccagcagcgcgccgagatccgccgcctgatcgcgatgttcgat
gagagcttcttcaacgacgtctccggtccgctgttgcatgagcggatgaagaagcgcctc
gtcctgcgccagtcgcctgacgccaagatgctgcgcgaggccatgaagctggcgcacgac
tatctcgattacatcgatttcctgatcgaccaccggccctggctcgccggctcgacgatg
acgctggccgacctgaccgcggccgcgcagatctccgttgccgactatctcggcggtatc
gactggtcgagccacgagcagtcgcgcggctggtatctcgtgatgaagtcgcgtcccagc
ttccgtccgctgctcagcgagcgcatggaagtcatccagccgccaagtcactacgccgaa
gtggatgcctga

DBGET integrated database retrieval system