KEGG   Novosphingobium pentaromativorans: JI59_08400Help
Entry
JI59_08400        CDS       T03399                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
npn  Novosphingobium pentaromativorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIT79798
UniProt: G6EDB7
LinkDB All DBs
Position
1763984..1765465
Genome map
AA seq 493 aa AA seqDB search
MATTATRSAQLRHPDAFFIGGEWVEPSTGSTIDVIDSSTEEVFLRVAEAQEEDVKRAISA
ARRAFDEGPWPRMSPQERAPFLEKIAAAWSERANALADSWTAESGVLRAISASAAPGLAS
TFRYYAELGRDFAWQEEHVSQTGQPALLVREPVGVVAAIVPWNAPHQLMTAKVAPALIAG
CTMIIKASPEAPSAPYHLAEICEEIGLPPGVVNVLTADREVSELLVRDPRVDKVSFTGST
AAGRKIASICGERIARVTLELGGKSPAVILDDYDLGTAARSIARYAPIMTGQVCSSLTRI
IVNKKRHDDLVAALADTFGKIQVGDPFEATSQMGPLAMARQRDRVEEMIAIGKAEGARLA
VGGVRPAHLNRGYYIEPTVFANVDNEATIAREEIFGPVLSVIPVANEEEAIAVANDTIYG
LNSSVFTNDPQRAYAVARRLRAGTVGHNGFKTDFTVGFGGFKQSGIGREGGIGGLHPYLE
AKTMIFEDMPTDR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaccgcaaccaggagtgcgcagttgcgccatccggatgcattcttcatcggc
ggcgaatgggtcgaaccttcgaccggatcgaccatagacgtgatcgacagcagcaccgaa
gaggtcttcctgcgcgttgccgaggcgcaggaagaagacgtgaaacgcgcgataagcgcc
gcaaggcgggcgtttgacgagggcccctggccgcgcatgagcccgcaggaacgtgcgccc
ttcctggaaaagatcgccgctgcctggagcgaacgcgccaacgccctcgccgatagctgg
accgctgaatcgggtgtgcttcgcgccatatcggcctcagccgcgcccggactggcaagt
acatttcgctactatgccgagcttggccgcgacttcgcatggcaggaagaacacgtttca
caaaccgggcagccagcgctgctggtgcgcgagccagtgggcgtggtggcggccatcgtt
ccgtggaacgcgccccatcagttgatgaccgccaaagtggcccctgcattgatcgcaggc
tgcacaatgatcataaaggcgtcgccagaagcgcccagcgccccctaccacctcgccgaa
atctgcgaggaaatcggcttgccgcccggcgtggtgaacgtgctcacggccgaccgcgaa
gtatcggaactgttggtgcgcgatccgcgcgtggacaaggtcagcttcactggttcaacc
gccgccgggcgcaagatcgcctcgatctgcggggagaggattgcgcgcgtcacgctggaa
ctgggaggcaagtctccagcggtgatccttgacgattacgaccttggcacggctgcccgg
tcgatcgcccgctatgcgccgatcatgaccggccaggtgtgctcctcgctgacccggatc
atcgtcaacaagaagcgtcacgacgatctggtggccgcgcttgccgataccttcggcaag
atccaggtcggcgacccgttcgaggcgaccagccagatgggcccgctggcgatggcgcgg
caacgcgatcgcgtggaggaaatgatcgccatcggcaaggctgaaggcgcgcgattggca
gtcggcggcgttcgccctgcgcacctgaaccgcggttactacatcgaacccaccgtattc
gcgaatgtcgacaacgaggccaccattgcgcgcgaggaaatcttcggcccggtgctcagc
gtcattcccgtggcaaacgaggaagaagcgatcgcggttgccaatgacacgatctacggc
ctcaacagcagcgtcttcaccaacgacccgcagcgcgcctatgcggtcgctcgccggctg
cgggccggcacggtcggccacaatggcttcaagaccgatttcaccgtcggcttcggcggt
ttcaagcaatccgggatcgggcgagaaggcggcattggcgggcttcatccctatcttgaa
gccaagacgatgattttcgaggacatgccgacggaccgctga

DBGET integrated database retrieval system