KEGG   Novosphingobium pentaromativorans: JI59_13545Help
Entry
JI59_13545        CDS       T03399                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
npn  Novosphingobium pentaromativorans
Brite
KEGG Orthology (KO) [BR:npn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JI59_13545
Enzymes [BR:npn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JI59_13545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 AlaDh_PNT_C K_oxygenase DAO Thi4 Spermine_synth FAD_binding_3 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIT80727
UniProt: G6EAY9
LinkDB All DBs
Position
complement(2791475..2793073)
Genome map
AA seq 532 aa AA seqDB search
MLDENLKQQLSQYLGMLREPIELVASLGDDAKSAETRDLLTQIAALSDKVTAQFDGDDAR
KPSFIIRRASNTEVWVRFAGVPLGHEFTSMVLALLWTGGHPPKVSDEVLDQIRQLEGDFD
FEMYFSLSCHNCPDVVQALTLMALYNPRITATLIEGGAFKDEVEGRGVLAVPAVFLNGEM
WGSGKMSIEEILGKLDKGADARTAAKLADKKPFEVLVIGGGPAGASAAIYTARKGFSTGI
AAERMGGQVMDTMGIENFISVPYTEGPKLAAALEQHVGEYDIDTMNLLRAEKLIPASEAG
GYHEVQFSNGASLKARSLVLTTGARWRNLGVPGEAEYRTKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDARLRADQVLQDKLRSMKNVDILVSAQTTEVTGD
GEKVNGLTYKDRDSGEEHHVELEGVFVQIGLVPNTEWLKDSGLEMTRFGEIVIDGKAATN
LPGVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRNEAPEEIAQAAQAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgaaaacctgaagcagcaactttcgcagtacctcggcatgctgcgcgaaccg
atcgaactcgttgcctcgcttggcgacgatgcaaagtcggccgaaacccgcgacctgctg
acccagatcgccgcgctctccgacaaggtcaccgcccaattcgacggcgacgacgcgcgc
aagcccagcttcatcatccgtcgtgcctcgaacaccgaggtatgggtccgcttcgccggc
gttccgctcggccacgaattcacgtccatggtcctcgctctgctctggaccggcggccac
ccgcccaaggtatccgacgaggtccttgaccagatccgccagcttgagggcgacttcgat
ttcgagatgtatttctcgctctcgtgccacaactgcccggatgtcgttcaggcgctgacc
ctgatggcgctctacaacccgcgcatcaccgccaccctgatcgaaggcggcgcgttcaag
gacgaggtcgaaggccgcggcgtcctcgccgtgcccgccgtgttcctcaacggtgagatg
tggggctcgggcaagatgagcatcgaggaaatcctcggcaagctcgacaagggcgccgac
gccaggaccgcggccaagcttgccgacaagaagcccttcgaggtgctcgtcatcggcggc
ggtcctgccggcgcctcggccgcgatctacaccgcgcgcaagggcttcagcaccggcatc
gccgccgagcgcatgggcggccaggtaatggacaccatggggatcgagaacttcatctct
gttccctacaccgaaggtcccaaacttgcagccgcgctggaacagcacgtgggcgaatat
gacatcgacaccatgaacctgcttcgtgccgagaagctgatcccggccagcgaagccggc
ggctatcacgaagtgcagttttcgaacggcgcatcgctcaaggcccgttcgctggttctc
accaccggcgcgcgctggcgcaacctgggcgtgcccggcgaggccgagtaccgcaccaag
ggcgtggcctattgcccgcactgcgacggccccctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaactcgggcgtcgaggcggcgatcgatctggccaatatcgtcggccac
gtcaccctgatcgagttcgacgccaggctgcgcgccgaccaggtcctgcaggacaagctg
cgttcgatgaagaacgtcgacatcctcgtctccgcccagaccaccgaggtcaccggcgac
ggcgagaaggtcaacggcctgacctacaaggatcgcgacagcggcgaggaacaccacgtc
gagctcgaaggcgtcttcgtgcagatcggactggtgcccaacaccgagtggctcaaggac
tcgggtctcgagatgacccgcttcggcgagatcgtgatcgacggcaaggcggcgaccaac
ctgcccggcgtctttgccgcaggcgatgccaccacggtgccctacaagcagatcatcatc
gccatgggcgaaggatcgaaggcggcgctctccgcgttcgactacctgatccgcaacgag
gcacccgaagagatcgcgcaggccgcccaggccgcctga

DBGET integrated database retrieval system