KEGG   Novosphingobium pentaromativorans: JI59_17015Help
Entry
JI59_17015        CDS       T03399                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00361  Chlorocyclohexane and chlorobenzene degradation
npn00625  Chloroalkane and chloroalkene degradation
npn01100  Metabolic pathways
npn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JI59_17015
   00361 Chlorocyclohexane and chlorobenzene degradation
    JI59_17015
Enzymes [BR:npn01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     JI59_17015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase
Motif
Other DBs
NCBI-ProteinID: AIT81364
UniProt: G6E8E8
LinkDB All DBs
Position
3501480..3502091
Genome map
AA seq 203 aa AA seqDB search
MSGTIEAVVFDVGRVLVQWDMRRLFAQLIDDADRLDWFMTHVVTEEWHFLHDAGRDLGEL
VAERKTQFPGNDHLIDAYATRFLETIPGNVPGSHEIVRELAGRDVPLFAITNFASPFWRE
YRESEPLFDLFGDIVVSGDEKIAKPDARIFEIASRRFGHEPGAMIFIDDNAANIEAADRL
GWNVHHFTDAPRLREDLTRRGLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgtccggaacaatcgaagccgtcgttttcgacgtgggccgggtgctcgtccagtgggac
atgcgccggctctttgcgcagctgatcgacgatgccgatcggctcgactggttcatgacc
catgtcgtgaccgaggaatggcacttcctgcacgacgccggccgcgaccttggcgaactg
gtcgctgagcgcaagacgcagtttcccggcaacgatcacctgatcgacgcttatgccacc
cgctttctcgagaccattcccggcaatgttccgggcagccacgagatcgtgcgcgaactg
gccgggcgcgatgtgccgctttttgccatcaccaatttcgccagtccgttctggcgcgag
taccgggagagcgagccgctgttcgacctgttcggcgacatcgtcgtttcgggcgacgag
aagatcgccaagcccgatgcgcgcatcttcgagatcgcctcgcgccgtttcggccatgag
cccggcgcgatgatcttcatcgacgacaatgcggcaaacatcgaagctgcggacaggctc
ggctggaacgtccatcactttaccgacgcgccccggctgcgcgaggacctgacgcggcgc
gggctactctga

DBGET integrated database retrieval system