KEGG   Novosphingobium pentaromativorans: JI59_18910Help
Entry
JI59_18910        CDS       T03399                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
npn  Novosphingobium pentaromativorans
Brite
Enzymes [BR:npn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     JI59_18910
Peptidases [BR:npn01002]
 Metallo Peptidases
  Family M2
   JI59_18910
Exosome [BR:npn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JI59_18910
CD molecules [BR:npn04090]
 Proteins
  JI59_18910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AIT81683
UniProt: G6E7B0
LinkDB All DBs
Position
3862439..3864265
Genome map
AA seq 608 aa AA seqDB search
MKFASTALAALAVSLAVPAVAKDAAADYPMTPEGAAQFVASAEKDLFDASVDNARINWVN
YTYITEDTDALVAQSNAAITEKQVDYAVEAAKYARVQGLDADVARKLGILRQGIVLPAPT
TPGAADELSAITTRLSSTYGKGKGTLDGKPINGSDIEAEMGNLDHTPAEYAEMWESWHDN
VGKPMKDDYAKMVTIANEGAKELGYSDVGAMWRSGYDMTPQQFSAETERLWQEVKPLYLA
LHTYVRRKLNEKYGDQVQPETGPIRADLLGNMWAQEWGNIYPLVAPQGAGDLGYDIGDLL
KAKGKTPLDMVKTGEGFYSSLGFAPLPDTFWTRSMITKPRDREVICHASAWDVDNKDDIR
IKMCTKVNSDDFVTIHHELGHNYYQRAYNKQPYLYLNGANDGFHEAIGDFIALSITPQYL
VDIGLLDKSKVPSADKDIGLLLRQAMDKVAFLPFGLLIDRWRWGVFDGSIKPADYNKAWT
DMRLEYQGIRPPVDRPANAFDPGAKYHIPGNTPYTRYFLARILQFQFYQAACEQAGWKGP
LHRCSFYGNRKVGENLDRMLEMGMSKPWPEALKAFTGSSKMSAKPMLEYFAPLKKWLDEQ
NKGQKQGR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcatctaccgcattggcggcgctggccgtcagcctggccgtaccggccgtg
gcaaaagacgctgcagccgactatccgatgacccccgaaggcgcggcacagttcgtcgca
tcggccgagaaggacctgttcgacgcttcagtcgacaatgcccggatcaactgggtgaac
tacacctacatcaccgaggataccgacgcgctcgttgcccagtcgaacgcggcgatcacc
gagaagcaggtagactatgcggtggaggccgcgaagtacgccagagtgcaggggctcgac
gccgatgtcgcccgcaagctgggcatcttgcgtcagggcatagtcttgcctgctccgacc
acgccgggcgctgccgatgaactgagcgcgatcaccacgcgcctgtcctccacttacggc
aagggcaagggcacgctagacggcaagccgatcaacggctcggacatcgaggcggagatg
ggcaacctcgaccataccccggccgaatatgccgagatgtgggagagctggcacgacaat
gtcggcaagccgatgaaggacgactacgccaagatggtgacgatcgccaacgaaggcgcg
aaggagcttggctattccgacgtcggcgcgatgtggcggtcgggctacgacatgacgccg
cagcagttttcggcagaaaccgagcgactgtggcaggaagtgaagccgctctatctggcg
ctgcacacttacgtgcgccgcaagctgaacgagaagtacggcgatcaggtccagcccgaa
accgggccgatccgcgccgacctgctgggcaacatgtgggcgcaggagtggggcaacatc
tatccgctcgtggcgccgcagggtgcaggcgatctgggctacgacatcggcgatctgctc
aaggccaagggcaagaccccgctcgacatggtgaagacgggcgagggcttctactcttcg
ctcggcttcgcgccgctgccggacacgttctggacccgttcgatgatcaccaagccgcgc
gaccgcgaggtgatttgccatgcctcggcctgggacgtcgacaacaaggacgacatccgc
atcaagatgtgcaccaaggtgaactcggacgatttcgtcacgattcaccatgaactgggg
cacaactactaccagcgcgcctacaacaagcagccctatctctacctcaacggcgccaat
gacggcttccacgaggcaatcggagacttcatcgcgctttcgatcacgccgcagtacctc
gtcgacatcggcctgctcgacaagagcaaggtccccagtgccgacaaggatatcggtctt
ctgctgcgacaggcgatggacaaggtggcgttcctgcccttcggcctgctcatcgatcgc
tggcgctggggcgtcttcgacggttcgatcaagccggcggactacaacaaggcctggacc
gacatgcggctggagtaccagggcatcaggccgccggtggaccgtccggccaatgctttc
gatccgggcgcgaagtaccatatcccgggcaacacgccctacacgcgctacttcctggcc
cgcatcctccagttccagttctaccaggccgcgtgcgagcaggctggctggaaggggccg
ctgcatcgctgcagcttctacggaaacaggaaggtgggcgagaacctcgaccgcatgctg
gagatgggcatgtccaagccctggccggaagcgctcaaggccttcaccggctcgagcaag
atgagcgcgaagccgatgctcgagtatttcgctccgctcaagaagtggctcgacgagcag
aacaagggccagaagcaaggccggtaa

DBGET integrated database retrieval system