KEGG   Novosphingobium pentaromativorans: JI59_24565Help
Entry
JI59_24565        CDS       T03399                                 

Definition
(GenBank) anthranilate 1,2-dioxygenase
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00627  Aminobenzoate degradation
npn01100  Metabolic pathways
npn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    JI59_24565
Enzymes [BR:npn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     JI59_24565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AIT82631
UniProt: G6EL42
LinkDB All DBs
Position
pLA1:complement(28229..28717)
Genome map
AA seq 162 aa AA seqDB search
MLLESPTRYELQQLVTELNALYAELIDDDRLEEWPDLFVSDCVYTVIARENFDRQMDTSA
IYCDSRGMLADRIVSLRKANIFPVHAYRHILGPTRIVSATGTLAKSHTSYAVLMTRTDGR
TTIYNSGKYIDEIDLSGERPLFRSKIAVFDTNLIDTMMVRPI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgagtcccctacgcgctacgagctgcagcaactcgtgaccgagctcaatgcg
ctctacgctgaactgatcgacgacgaccggctggaagagtggccggatctgtttgtttcg
gactgcgtctacaccgtgatcgcgcgcgagaatttcgaccggcaaatggatacgtcggcg
atttattgcgacagccgcggaatgctggccgatcgcatcgtgtcgctgcgcaaggccaac
atcttcccggtgcatgcctaccgacatattctcggtccgacccgaatcgtttccgcaacc
ggaacgctcgccaagtcgcacaccagctatgcggtccttatgacccgcactgacggacgc
accacaatctacaattcgggcaagtatatcgacgagatcgacttgtctggcgagcgcccc
ttgttccgctcaaagatcgccgttttcgataccaacctcatcgacacgatgatggttcgc
ccgatttag

DBGET integrated database retrieval system