KEGG   Novosphingobium sp. PP1Y: PP1Y_AT15827
Entry
PP1Y_AT15827      CDS       T01515                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00071  Fatty acid degradation
npp00360  Phenylalanine metabolism
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP1Y_AT15827
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PP1Y_AT15827
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     PP1Y_AT15827
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox DAO Pyr_redox_3 2-Hacid_dh_C TrkA_N Amino_oxidase AlaDh_PNT_C NAD_binding_7 3HCDH_N XdhC_C ThiF
Other DBs
NCBI-ProteinID: CCA92465
UniProt: F6IM13
LinkDB
Position
1671990..1673231
AA seq 413 aa
MGENLVRSIAVVGANLAGGRAVEALRQSGFDGRIALIGEEPWRPYERPPLSKEVLWDPAN
VPDNFFLQDEAWYEDNRIDMRLGIRAEAIDLVSGGVRLAGGELVQADRILLATGGHARKL
NLAGADCANVHYLRTRDDATRMALDLREGASIVIVGMGVIGAEVAASAVKLGCKVTVVEP
MPVPMERALGRRFGQWLGDEHRKRGVTTHFNCGVTGFRFADNRVSAVETDDGTVIPCDAV
IVGVGIVPATSLARDAGIEVNNGIIVDRRCQTSNPAIFAAGDVAEQDGFFGGRFRQETYQ
NAADQAQAAALAMLGQEVSYCKPMWYWSDQFDLNIQFCGQIPVEAEVAIRGEMDSNAFVA
FFLAGETIEGVLTVNRAPDMGVGKRLVERRARASAASLADAGVSLRDLLRQAG
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgggagaaaacttggtgcgctcgattgcggtagttggtgcaaatctggccggtgggcgg
gcggtcgaagccttgcgtcagtccgggttcgatggacggatcgccctgatcggcgaagaa
ccgtggcgtccctacgagcggccgccgctgtccaaggaagtgctgtgggatccggccaat
gttccggacaacttcttcctgcaggacgaagcctggtacgaggacaaccggatcgacatg
cggctgggcatacgcgccgaagcgatcgaccttgtcagcggcggcgtgcgtctggcgggc
ggcgaactggtgcaggcggaccggatactgctcgccacgggcggccatgcccgcaaactc
aaccttgccggagccgattgcgccaacgtccactacctgcgcacgcgcgacgatgcgacc
cgcatggcgcttgacctgcgcgaaggggccagcatcgtgatcgtcggcatgggcgtgatc
ggtgcagaagtcgccgccagcgcggtgaagcttggctgcaaggtcaccgtcgtcgagccg
atgccggtgccgatggagcgcgcactcggccggcgctttgggcaatggctgggcgatgaa
catcgcaagcggggcgtgacgacccacttcaactgcggcgtgaccggcttcaggtttgcc
gacaaccgcgtgagcgcggtcgagacggacgatggcacggtgatcccctgcgatgccgtc
atcgtgggggtggggatcgtgccggccacttcgctggcccgcgatgccgggatcgaggtc
aacaacgggatcatcgtcgatcgccgctgccagaccagcaatccggcaatattcgcggcg
ggcgacgtggccgagcaggacgggtttttcggcggacggttccgccaggaaacctaccag
aacgcggcggaccaggcgcaggcggccgccctcgcgatgctggggcaggaggtctcctac
tgcaagccgatgtggtactggagcgaccagttcgatctcaacatccagttctgcgggcag
attccggtggaggccgaggtggcgatccgtggcgagatggacagcaacgccttcgtcgcc
ttcttcctggcgggcgagacgatcgaaggtgttctgaccgtcaatcgcgcccctgacatg
ggggttggcaagcggctcgtcgaacgccgggcccgcgccagcgcggcaagcctagccgac
gcgggcgtgtccttgcgggatctgctcaggcaggctggctga

DBGET integrated database retrieval system