KEGG   Novosphingobium sp. PP1Y: PP1Y_AT19001Help
Entry
PP1Y_AT19001      CDS       T01515                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00970  Aminoacyl-tRNA biosynthesis
npp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PP1Y_AT19001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:npp03029]
    PP1Y_AT19001
Enzymes [BR:npp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PP1Y_AT19001
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PP1Y_AT19001
Mitochondrial biogenesis [BR:npp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PP1Y_AT19001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey RTC_insert
Motif
Other DBs
NCBI-ProteinID: CCA92781
UniProt: F6IMX9
LinkDB All DBs
Position
2011862..2013361
Genome map
AA seq 499 aa AA seqDB search
MADSTYRIQGATGDWEVVIGLEVHAQVTSNSKLFSGSATAFGAEPNSQVSLVDAAMPGML
PVLNRECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEIA
LDDKNPEDTKTIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAE
AGAYVSKLRTILRYVGSCDGNMDQGSMRCDVNVSVRRPGEEFGTRTETKNVNSVRFVMQT
IEHEANRQVDVLESGGKIVQETRLFDPTSGTTRSMRSKEDAHDYRYFPDPDLLPLELDDA
FLEECRASLPELPDAKRHRYENELGLSPYNAGVLTAEVETARWFERLLAETARAAGKQPA
EVAKQAANWLISELFGALNKLGTSLEESPVTPEKGGDLLALIAKGTISGSAAKQVLEIML
ETGEDAGVIVEREGLKQESDTGAIEAEVDKVLAANADKVEQYKAGKEALFGFFVGQTMKA
MKGKGNPQVVNEILKAKLA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagcacttatcgcatccagggcgcaaccggtgactgggaggtcgtgatcggc
ctcgaagtccacgcgcaggtcacttcgaactccaagctgttctccggctcggcaaccgcg
ttcggcgcggagccgaactcgcaggtcagccttgtcgatgcggcgatgccggggatgctc
cccgtgctcaaccgcgagtgcatccgccaggcggtgcgcaccggcatggccatcgacgcg
cagatcaacaagtggtcgcgcttcgaccgcaagaactacttctacgcggacttgccgcag
ggctaccagatcagccagctctaccacccgctggtgggcgagggtgcgatcgagatcgcg
ctggacgacaagaaccccgaagacaccaagaccatcggcatcgagcgcatccacgtcgaa
caggacgcgggcaagctgatgcacgaccagcatccgacgatgtcctacgtcgatctcaac
cgctctggcgtggcgctgatggaaatcgtcagccgtccggacatgcgttctcccgcagag
gcaggggcttacgtctcgaagctgcggacgatcctgcgctatgtcggctcatgcgacggc
aacatggaccagggctcgatgcgctgcgacgtcaatgtgtcggtgcgccgcccgggcgag
gaattcggtacccgtaccgagaccaagaacgtcaactcggtgcgcttcgtcatgcagacg
atcgagcatgaggcgaaccgccaggtcgacgtgctcgagagcggcggcaagatcgtgcag
gaaacccgcctgttcgatccgaccagcggcacgacccgttcgatgcgctctaaggaagat
gcgcacgactatcgctacttccccgatcccgacctcctgccgctcgagctggacgacgcg
ttcctcgaagagtgccgcgcctcgctgcccgaactgccggacgccaagcgccaccgctat
gagaacgagctgggcctttcgccctacaatgcgggcgtgctgaccgccgaggtcgagacc
gcgcgctggttcgaacgtctccttgccgaaactgcacgggcggccggcaagcagcccgcc
gaagtcgccaagcaggcggccaactggctgatctccgaactgttcggtgcgctcaacaag
ctgggcacttcacttgaggaatcgccggtaacccccgaaaagggcggcgatcttctcgcc
ctgatcgccaagggcacgatctccggctcggcggccaagcaggtgctcgagatcatgctc
gagacgggcgaagacgcaggcgtgatcgtcgagcgcgaaggcctcaagcaggaatcggac
accggcgccatagaggccgaggtggacaaggtgctcgctgccaatgccgacaaggtcgag
cagtacaaggcgggcaaggaagccctgttcggcttcttcgtcggccagacgatgaaagcc
atgaagggcaagggcaacccgcaggtcgtcaacgaaatcctgaaggccaagctggcctga

DBGET integrated database retrieval system