KEGG   Novosphingobium sp. PP1Y: PP1Y_AT1991
Entry
PP1Y_AT1991       CDS       T01515                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00071  Fatty acid degradation
npp00360  Phenylalanine metabolism
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP1Y_AT1991
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PP1Y_AT1991
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     PP1Y_AT1991
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox Pyr_redox_3 FAD_binding_2 NAD_binding_8 DAO GIDA Lycopene_cycl HI0933_like Thi4 FAD_binding_3 Trp_halogenase 3HCDH_N AlaDh_PNT_C UDPG_MGDP_dh_N NAD_binding_7 TrkA_N K_oxygenase FAD_oxidored 2-Hacid_dh_C Shikimate_DH
Other DBs
NCBI-ProteinID: CCA91171
UniProt: F6IGA5
LinkDB
Position
218023..219249
AA seq 408 aa
MSKADVVIVGAGHGGAQCAIALRQNGFEGTITVIGREPEYPYERPPLSKEYFAREKTFDR
LYIRPPTFWAEKNIAFKLGTEVTKVDPKAHELTLSNGESYGYGKLVWATGGDARRLSCQG
ADLTGIHAVRTREDCDTLMAEVDAGTKNIVVIGGGYIGLEAAAVLSKMGLKVTLLEALPR
VLARVAGEDLSTFYQKEHAEHGVDLRTEVMVDSLVGENGKVTGVQLAGGEVIPAEGVIVG
IGIVPAVGPLIAAGAAGANGVDVDEYCRTSLPDVYAIGDCAAFACDYAGGNVMRVESVQN
ANDMGTCVAKAICGDEKPYKAFPWFWSNQYDLKLQTAGINVGFDKTVIRGNPEERSFSVI
YLKDGRVLALDCVNMVKDYVQGRKLVEAGATPDLEALADAAKPLKELL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagcaaggcagacgtcgtaatcgtgggagccgggcatggcggtgcacagtgcgcgatc
gcccttcgccagaacggcttcgaaggcaccatcaccgtcatcggccgtgagccggaatat
ccctatgagcgcccgccgctctcgaaggaatatttcgcgcgggagaagaccttcgatcgt
ctctacatccgtccgccgacgttctgggccgagaagaacatcgcgttcaagctgggcacc
gaagtcaccaaggtcgatcccaaggcgcacgaactgacgctctccaacggcgagagctat
ggctacggcaagctcgtctgggccaccggcggggatgcccgtcgcctctcgtgccagggc
gcggaccttaccggcatccacgccgtgcgcacccgcgaggactgcgacacgctgatggcc
gaagtcgatgccggcacgaagaacatcgtcgtcatcggcggcggctacatcggcctggaa
gccgcggccgtgctgtccaagatgggcctcaaggtcacgctgctcgaagcgcttccgcgc
gtgctggcacgcgttgcgggtgaagacctgtccaccttctatcagaaggaacacgccgaa
cacggcgtcgacctgcgcaccgaagtcatggtcgacagcctcgtcggcgagaacggcaag
gtgaccggcgtgcagcttgccggcggcgaagtgattccggccgaaggcgtcatcgtcggc
atcggcatcgtgcctgccgtcggtccgctgatcgcggccggcgctgccggcgccaatggc
gtcgacgtggacgagtattgccgcacctcgctgcccgacgtctatgcgatcggcgactgc
gcggctttcgcctgcgattatgcgggcggcaacgtgatgcgcgtggaatcggtgcagaac
gccaacgacatgggcacttgcgtggccaaggcgatctgcggcgacgagaagccctacaag
gcgttcccgtggttctggtcgaaccagtacgacctcaagctgcagacggccggcatcaat
gtcggcttcgacaagaccgtgatccgcggcaatccggaggagcgcagcttctcggtcatc
tatctcaaggatggccgcgtcctcgccctcgactgcgtgaacatggtcaaggactacgtg
cagggccgcaagctggtcgaagccggggccacccccgatctcgaagcgctggccgatgcg
gccaagccgctgaaggaactgctctaa

DBGET integrated database retrieval system