KEGG   Novosphingobium sp. PP1Y: PP1Y_AT21498
Entry
PP1Y_AT21498      CDS       T01515                                 

Definition
(GenBank) thioredoxin reductase (NADPH)
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PP1Y_AT21498
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     PP1Y_AT21498
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_binding_2 HI0933_like GIDA FAD_oxidored NAD_binding_7 NAD_binding_8 FAD_binding_3 Shikimate_DH Thi4 NAD_binding_9 K_oxygenase FMO-like Staph_opine_DH
Other DBs
NCBI-ProteinID: CCA93018
UniProt: F6INL6
LinkDB
Position
2281670..2282641
AA seq 323 aa
MATTHKTRMLIIGSGPAGLSAAIYGARAGMEPIVVQGLQPGGQLTITTDVENYPGFREVI
QGPWLMQEMQAQAEHVGTRMMWDTITSVDLSGDKFTAQGDSGDVYEGDTLVIATGAQARW
LGVPGEQELSGKGVSACATCDGFFYRGKKVVVIGGGNTAVEEALYLTNHSDDVTLIHRRD
SLRAEKILQDRLFAHPKINVVWNKRVDSFLGGGEGGGLRALKLIDTVTGEESEIETEGAF
VAIGHAPATELFKGQLAMDESGYLLVEPGTPKTDVPGVFACGDVMDHVYRQAITAAGTGC
MAALDAERFLAEKEFAESAKVEA
NT seq 972 nt   +upstreamnt  +downstreamnt
gtggcgacgacgcacaagacccgcatgctcattatcggttccggtccggccggactttct
gccgcgatctacggtgcccgcgcaggcatggagccgatcgtggtgcagggcctccagccc
ggcggccagctcaccatcaccaccgatgtcgagaattatcccggtttccgtgaagtcatc
cagggtccgtggttgatgcaggaaatgcaggcccaggccgaacacgtcggcacgcgcatg
atgtgggatacgatcacctcggtcgatctttcgggcgacaagttcaccgcgcagggcgat
agcggcgatgtttacgagggtgacacgcttgtcatcgccaccggtgcgcaggcgcgctgg
ctcggcgttcccggcgagcaggaactctcgggcaagggcgtttcggcctgcgccacctgc
gacggcttcttctatcgcggtaagaaggtcgtggtcatcggcggcggcaacaccgccgtg
gaggaagcgctctacctcaccaaccattcagatgacgtcaccctgatccaccgccgcgat
tcgctgcgcgccgagaagatcctgcaggaccggctcttcgcgcatcccaagatcaacgtc
gtgtggaacaagcgcgtcgacagcttcctgggcggcggcgagggcggcggcctgcgggcg
ctcaagctgatcgatacggtgaccggcgaggagagcgagatcgagaccgaaggcgccttc
gttgccatcggccacgccccggcgaccgagctgttcaagggccagcttgccatggacgag
tcgggctacctgctcgtcgagcccggcacgcccaagaccgacgtcccgggcgttttcgcc
tgcggcgacgtgatggaccatgtatatcgtcaggcgattaccgctgcgggcaccggctgc
atggccgcgctcgatgccgaacgcttccttgccgaaaaggaatttgccgagtcggccaag
gtcgaggcctga

DBGET integrated database retrieval system