KEGG   Novosphingobium sp. PP1Y: PP1Y_AT28774Help
Entry
PP1Y_AT28774      CDS       T01515                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00030  Pentose phosphate pathway
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
npp01230  Biosynthesis of amino acids
Module
npp_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
npp_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP1Y_AT28774
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PP1Y_AT28774
Enzymes [BR:npp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PP1Y_AT28774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh Alba
Motif
Other DBs
NCBI-ProteinID: CCA93657
UniProt: F6IFZ9
LinkDB All DBs
Position
complement(3022096..3024084)
Genome map
AA seq 662 aa AA seqDB search
MTLAPNRLAPMANAIRALSMDAVQAANSGHPGMPMGMADVATVLFSKFLKFDPAAPKWAD
RDRFVLSAGHGSMLIYSLLHLTGYASPTMDDIRNFRQLGSVCAGHPENFLIPGVECTTGP
LGQGLAMAVGMAMAERQLNGTFGDDLVDHKTWVIAGDGCLMEGINHEAIGLAGNLKLGRL
KVLWDDNNITIDGDTSLSTSEDIPARFRATGWDVFSCDGHDFADIERALAEAAASDKPSL
VACKTVIGKGAPNKQGSHDVHGAALGPDEVAAAREFLGWTAAPFEIPAEILADWRSLGEA
GAKARAEWEGRLAASADAAEFNRRMAGDLPEGDEAAKTFAGWLDGDTTVATRKASENCLN
VLAPVVPEMVGGSADLTGSNNTKAKCQEPFTPENYAGRYVYYGIREFGMAAAMNGMALHG
GVIPYGGTFLIFSDYCRNAIRLSALQQTRAIYVLTHDSIGLGEDGPTHQPIEQVMSLRLI
PNLYVFRPADVIETAECWNIALQSKDTPSVLALTRQNLPQLRNSGDMLSARGAYTLRHAA
ADRKVILIASGSEVELAVKVAEQLESQNIGADVVSMPCMELFEAQDEAYKHEVLPHDASV
LRVSIEAGSTLGWERYTAASRNGGLNIGIDRFGASAPAKDLFARFGFTAESIVPKILDKL
SA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgcccccaaccgcctcgcgccgatggccaatgccatccgggcgctttcgatg
gatgcggtccaggctgccaacagcggtcaccccggcatgccgatgggcatggcggacgtc
gccacggtgctgttctccaagtttctcaagttcgatcccgccgcgccaaagtgggccgac
cgcgaccgcttcgtgctctcggccggccacggctcgatgctgatctactcgctgctccac
ctgaccggctatgccagcccgacgatggacgacatccgcaacttccgtcagctcggctcg
gtctgcgccggtcacccggaaaacttcctgatcccgggcgtggaatgcaccaccggtccg
ctggggcagggcctggcgatggcggtcggcatggcgatggccgagcgtcagctcaacggc
actttcggtgacgacctcgtcgaccacaagacctgggtcatcgccggtgacggctgcctc
atggaaggcatcaaccacgaggcgatcggcctggccggcaacctcaagctgggccgcctc
aaggtcctgtgggacgacaacaacatcaccatcgacggcgatacctcgttgtcgacgagc
gaagacatccccgcgcgcttccgcgctaccggttgggacgttttctcgtgcgacggccac
gactttgccgatatcgagcgtgcgctggccgaagccgctgcctcggacaagccctcgctc
gttgcctgcaagacggtgatcggcaagggcgcacccaacaagcagggcagccatgacgtt
cacggtgctgcgctcggccccgatgaagtcgccgccgctcgtgaattcctgggctggacg
gcagctccgttcgagatcccggccgagatccttgccgactggcgttcgctgggcgaagcc
ggggccaaggcccgcgccgagtgggaaggccgcctggccgccagcgccgacgctgccgaa
ttcaaccgccgcatggccggcgatcttccggaaggcgacgaggctgcgaagactttcgcc
ggctggctcgacggcgacaccaccgtcgctacccgcaaggcttcggaaaactgcctcaac
gtcctggcgccggtggtgcccgagatggttggcggttcggccgaccttaccggctcgaac
aacaccaaggccaagtgccaggagccgttcaccccggaaaactacgccggtcgctatgtc
tattacggcatccgcgaattcggcatggccgcggcgatgaacggcatggcgctgcatggc
ggcgtcattccctacggcggcaccttcctgatcttctcggactactgccgcaatgcgatc
cgcctctcggcgctgcagcagacccgcgcgatctacgtcctgacccacgattccatcggc
ctgggcgaagacggtccgacccaccagccgatcgagcaggtcatgagcctgcgcctgatc
ccgaacctctacgtgttccgccccgcggacgtgatcgagacggcagagtgctggaacatc
gcgctgcagtccaaggatacgccttcggttcttgcgctgacccgccagaatctgccgcag
ctgcgcaatagcggtgacatgctttcggcgcgcggcgcctacacgcttcgtcatgctgcg
gccgaccgcaaggtcattctgatcgccagcggttccgaagtggaactggccgtgaaggtc
gccgagcagctggaatcgcagaacatcggcgccgatgtcgtctcgatgccctgcatggag
ctgttcgaagcgcaggatgaagcgtacaagcacgaagtgctgccgcacgatgcgtctgtc
ctgcgcgtttcgatcgaggccggctcgacgctgggctgggagcgctataccgctgcgagc
cgcaacggcggtctcaacatcggcatcgaccggttcggcgcgtccgcgccggcaaaggac
ctgttcgcacgcttcggtttcaccgccgaatccatcgtgcccaagattcttgataagcta
agcgcctaa

DBGET integrated database retrieval system