KEGG   Novosphingobium sp. PP1Y: PP1Y_AT36025
Entry
PP1Y_AT36025      CDS       T01515                                 

Definition
(GenBank) FAD dependent oxidoreductase
Organism
npp  Novosphingobium sp. PP1Y
SSDB
Motif
Pfam: DAO FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_3 GIDA Pyr_redox Thi4 HI0933_like Amino_oxidase Pyr_redox_3 AlaDh_PNT_C Trp_halogenase Lycopene_cycl ApbA 3HCDH_N NAD_binding_7 UDPG_MGDP_dh_N TrkA_N
Other DBs
NCBI-ProteinID: CCA94321
UniProt: F6IJR7
LinkDB
Position
3782977..3784299
AA seq 440 aa
MSPYVERISSDERLPETADVVIVGGGIVGVSAAYFLARQGHSVALIEKGHIACEQSSRNW
GWCRQQNRDHRELPLSSVSMRLWDEFSKELDHDVGFQRCGLFYATDNEAQLAEWAKWQPY
GLENGVETQMLSAAEIARHIPEGSRKWIGGVSSPNDGKAEPALAAPAIALGARAHGATIH
QGCAARSLEITNGRVVGVNTEHGLIKADAVLCAAGAWASRFLRPHGINFPQAGVRQTAIR
TKPMNDVGGCLYAPDFAMTRRLDGSYTLAISGKATIDLTPQGIRYSREFLPQFKRRLKNV
RLAIGPSFVTGPESLFSLLRNDETLFERTRVLDPNPQQWLVRRILANVARAFPQFAGVEL
AGAWGALVDCSPDAVPVISKTDKVEGLVLAAGCSGHGFGMGPGIGLLASQLLVNDTPCVD
AAPFRLSRLVDGSPLEIGGL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtcaccatacgtcgaacgcatatccagcgacgagcgcctgcccgaaaccgccgatgtg
gtcatcgtgggcggcggtatcgtcggtgtatcggcggcatattttctcgctcggcagggc
cattcggtcgcgttgatcgaaaagggccatattgcgtgcgaacagtcgagccgtaactgg
ggttggtgccgtcagcaaaatcgcgatcaccgcgaattgcccctctcctcggtttcgatg
cgcctgtgggacgaattctcgaaagaactcgaccacgacgtcggatttcagcgctgcggc
cttttctacgcgaccgataacgaagcccaactggccgaatgggcgaaatggcagccctac
gggcttgagaacggcgtcgagacgcaaatgctcagcgccgcggaaatcgctcggcatatt
cccgaaggctcgcgcaagtggatcggtggcgtttcctcacccaacgacggcaaggcagaa
ccggcgcttgctgcccccgcgatcgcgctcggtgcgcgcgcccacggcgcgacaattcac
caaggatgtgccgcccgctcactcgagattacgaacggccgagttgtcggcgtgaatacg
gaacatggcctgatcaaggccgatgcggtcctgtgtgcagccggcgcctgggcctcgcgg
ttccttcgcccgcacggtatcaacttcccgcaagccggcgtgcgacagacggccatacgc
acgaaacccatgaacgacgttggagggtgtctttatgcccccgacttcgcgatgacgcga
cggcttgatggtagctacactctggcgatcagcggtaaggcaacgatcgacctgacgccg
caaggcatccgttattcccgcgagttcctgcctcagttcaagcgtcgcctcaagaacgtc
aggctggcgatcgggccctccttcgtgaccggcccggaatcccttttctcgctgctcagg
aacgatgaaacgcttttcgaaagaacccgcgttctcgatcccaatccccagcaatggctc
gtacgcaggatcctggccaacgtcgcccgtgcgtttccccagtttgcaggtgtcgaattg
gccggagcatggggcgcgcttgtcgactgttctcccgatgcggtgcctgtcatttcgaaa
acggataaagttgaagggcttgtcttggccgcgggctgttcgggccatggttttggcatg
gggccggggattggcctgctcgcctcgcaattgctggtgaacgacaccccatgcgtggac
gccgcgccatttcgcctgtcgcgtctcgtggacggttccccactcgaaatcggcggactt
taa

DBGET integrated database retrieval system