KEGG   Novosphingobium sp. PP1Y: PP1Y_AT590Help
Entry
PP1Y_AT590        CDS       T01515                                 

Definition
(GenBank) enoyl-[acyl-carrier protein] reductase I
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00061  Fatty acid biosynthesis
npp00780  Biotin metabolism
npp01100  Metabolic pathways
npp01130  Biosynthesis of antibiotics
npp01212  Fatty acid metabolism
Module
npp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PP1Y_AT590
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PP1Y_AT590
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PP1Y_AT590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:npp01004]
    PP1Y_AT590
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PP1Y_AT590
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PP1Y_AT590
Lipid biosynthesis proteins [BR:npp01004]
 Fatty acid synthase
  Component type
   PP1Y_AT590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CCA91036
UniProt: F6IFG1
LinkDB All DBs
Position
61363..62166
Genome map
AA seq 267 aa AA seqDB search
MTGLMQGKRGLIMGLANDKSLAWGIARKLHEHGAELAFSYQGEALAKRVKPLAESLGSDF
LVECDVANMEAVDVCFDQIRERWDTIDFIVHAIGFSDKSELRGKYVDTSLENFLMTMNIS
AYSLVAVTKRAMEMMPNGGSILTLTYYGAEKVVPHYNVMGVAKAALETSVQYLANDLGPQ
NIRVNAISAGPIKTLAASGIGDFRYILKWNELNSPLRRNVTIEDVGGSGLYFLSDLSSGV
TGETHHVDAGYHVVGMKQEDAPDIALT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtctgatgcaggggaaacgcggcctgatcatgggcctagccaatgacaagtcg
ctggcctggggcattgccaggaagctgcatgaacacggcgccgagctggccttctcctat
cagggggaagcactcgccaagcgcgtgaagcctctggctgaaagccttggcagcgatttt
ctcgtcgaatgcgacgtggcgaacatggaagcggtcgatgtgtgcttcgaccagatccgt
gagcgctgggacacgattgacttcatcgtccacgccattggcttttcggacaagagcgag
ctgcgcggcaagtacgtcgataccagcctcgaaaacttcctgatgacgatgaacatttcc
gcctacagcctcgtcgcggtgacgaagcgggcgatggaaatgatgccgaatggcggctcg
atcctgacgctgacctattacggcgcggaaaaggtcgtgccgcactacaacgtcatgggc
gtggccaaggccgctctcgagacttcggtgcagtaccttgccaacgatctcggcccgcag
aacatccgagtcaatgcgatctcggccggtccgatcaagacgctggctgccagcggcatc
ggcgatttccgctacatcctgaagtggaacgagctgaactcgccgctgcgccgtaacgtc
acgatcgaggacgtcggcggttcgggcctctatttcctctcggacctctcctcgggcgtg
accggcgagacgcaccatgtcgatgccggctaccacgtcgtgggcatgaagcaggaagat
gctcccgacattgccctgacctga

DBGET integrated database retrieval system