KEGG   Novosphingobium sp. PP1Y: PP1Y_AT6901Help
Entry
PP1Y_AT6901       CDS       T01515                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00620  Pyruvate metabolism
npp00680  Methane metabolism
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01200  Carbon metabolism
Module
npp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP1Y_AT6901
  09102 Energy metabolism
   00680 Methane metabolism
    PP1Y_AT6901
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PP1Y_AT6901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF1466
Motif
Other DBs
NCBI-ProteinID: CCA91634
UniProt: F6IJ08
LinkDB All DBs
Position
complement(736139..738925)
Genome map
AA seq 928 aa AA seqDB search
MSGAALNTVEDLNARLRELHPLTAQTPLYNPVFQLGLELSRKLENGEMSLDDIERLVAEM
ECEGLRARAARLDRLVKPVPVAQNDVRIDEIANEEEFTEFAARWQRPAAHVVFTAHPTFL
LTAGQTEAVTHSASNGDFSEASVCAASPERDTITLDYEHDKAMAALARGQKARDRISARL
FDIAATRWPKRWKSLQPMPVRFATWVGYDMDGRTDISWSTSIRYRLEEKAMRLAAYAQDL
MSTEPAIAERLERAGKLAADMAARFAEDLSQPEALSAAANALTAEHPDKLVSLEGVIAEL
EEEARHADQDVARQLLVVAAAMRSDGLGMGWIHFRVNSSQLQNAIRRRIDPDGKLSLASQ
AALVRMRELLAEVKPLRSNFAALAIENSTAVRQFLAMAQILQHIDSDTPIRMLVAECEQP
TTVLAALYFARMFGIDDKVDVSPLFETESALEHGGRFLDAVLSEPAYREYARKRGRVSIQ
TGFSDAGRFVGQIPAALAIERLQGRLAEAMAANAMTDVAALIFNTGGESMGRGAHPSSIE
DRFDWQMSPWARRRFLRAGIRLEPEVSFQGGDGYLWFGSDELALATLTRMAERPLWGADT
NSPTDVFYRRTDLSLDFYRAIRGVQHEHLESHTYSRAITAFGLGLLNDTGSRKSRRQSDL
SGDRTMSLRQIRAIPHNAILQQLGYPVNVIAGIGTAADGNIEEIASLLIESERGRQLIRL
ARAANALGSIKTVAAYGELFNSAYWASRPYRGDEQHISDACLKIGEYLTKDDRTGVFRRL
ASRLRVDAMKLHRLLDQIPDESPLPDREHTRRSLGVLQSLRIALFKHMFLRAVMVPAFSR
ANDISREDVLEMFFSLRVDDGLSQLRRAFPISFPSINDFSVDLPSDYPDSSASGYSQIHR
DYIDPIARSYALSLRITTAIANEFGAHG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggcggcgttgaacacggtcgaggacctcaacgcccgcctgcgggagctgcac
cccctgacggcgcagaccccgctttacaatccggtgttccagctcgggcttgagctttcg
cgcaagctcgagaacggcgaaatgtcgctcgatgacatcgagcggctggtcgccgaaatg
gaatgcgagggcctgcgggcccgcgccgcccggctcgaccgcctcgtcaaaccggtcccc
gtcgcgcagaacgacgtgcggatcgacgaaatcgcgaacgaggaagagtttaccgagttc
gccgcccgctggcagcgtcctgccgcacatgtcgtcttcaccgcgcatcccacgttcctg
ctcaccgcaggacagaccgaagcggtgacgcattcggcatccaacggcgatttcagcgaa
gcctcggtttgcgccgcttcgcccgaacgcgacacgatcacgctcgactacgaacacgac
aaggcgatggccgcgctcgctcgtggccagaaggcccgcgaccggatcagtgcccgcctg
ttcgatatcgccgccacccgctggcccaagcgctggaagagcctgcagccgatgccggtg
cgcttcgccacctgggtcggctacgacatggacgggcgcaccgacatctcgtggtccact
tcgatccgttatcgcctcgaggaaaaggcgatgcggctggccgcctatgcgcaggacctc
atgtccaccgagcccgccattgccgagcggctcgagcgcgcgggcaagctcgccgcggac
atggccgcgcgctttgccgaagacctgtcccagcccgaagcgctctcggctgcggccaat
gcgctgaccgccgaacatcccgacaagctggtcagccttgaaggtgtgatcgccgagctg
gaagaggaagcgcgccacgccgatcaagacgtcgcgcgccagttgctcgtggtggccgca
gcgatgcgctccgatggcctgggcatgggctggatccacttccgggtgaactcctcgcag
cttcagaacgcgatccgccgccgcatcgatccggacggcaagctcagcctcgccagccag
gcggcgctggtccgcatgcgcgaactgctggccgaggttaagccgctgcgttccaacttc
gcggcgctggcgatcgagaacagcacggcggtgcgccagttcctggcgatggcgcagatc
ctgcagcacatcgattccgatactccgatccgcatgctcgtggccgagtgcgaacagccg
actacggtgctggccgccctctacttcgcgcgcatgttcgggatcgacgacaaagtcgat
gtctcgcccctgttcgagacggagagcgcgctggaacacggcggccgattcctcgacgca
gtgctgtcagaaccggcttaccgcgaatatgcccgcaagcgcgggcgcgtctcgatccag
accggcttctccgacgcgggccgcttcgtcggccagattcccgccgcactcgccatcgag
cgcctgcagggccgccttgccgaagccatggccgcgaacgcgatgaccgacgttgccgcg
ctgatcttcaacaccggcggcgaatccatgggccgcggcgcccatccttccagcatcgag
gaccgcttcgactggcagatgtcgccctgggcccgccgccgcttcctgcgcgccgggatc
aggctggagcccgaagtctcgttccagggcggcgacggctatctctggttcggatcggac
gaactggccctggcgacgctgacccgcatggccgaacggccgctgtggggtgcggatacc
aattcgccgaccgacgtgttctatcgccgtaccgacctcagcctcgacttctaccgggcg
atccgcggcgtccagcacgaacacctggaaagccacacttactcgcgcgcgatcaccgcc
ttcggcctgggcctgctcaacgataccggcagccgcaagtcgcgccgacagtcggatctt
tccggcgaccggaccatgagcctgcgccagatccgcgcgatcccgcacaatgcgatcctc
cagcagcttggctatccggtgaacgtgatcgccgggatcggcacggcggccgatggcaac
atcgaggaaatcgccagcctgctcatcgaaagcgagcgcgggcgccagctcatccgactc
gcccgcgcggccaatgcgctgggttcgatcaagaccgtggccgcctatggcgagctgttc
aactcggcctactgggccagccgcccctatcgcggcgacgagcagcacatctccgatgcc
tgcctcaagatcggcgagtacctgaccaaggacgaccggaccggcgtgttccgccgcctc
gcctcgcgcctgcgggtcgatgcgatgaagctgcaccgcctgctcgaccagatcccggac
gaatcgccgctgcccgaccgcgagcatacccgccgcagcctcggcgttctgcaatcgctg
cggatcgcgctgttcaagcacatgttcctgcgcgcggtcatggttccggccttcagccgc
gccaatgacatcagccgcgaggacgtgctggagatgttcttctcgctgcgcgtcgacgat
ggtctgtcgcagctgcgccgggcgttcccgatcagcttcccgtcgatcaacgacttcagc
gtcgacctgccgagcgattatccggactcgagcgcgtcgggctattcgcagatccaccgc
gactacatcgatcccatcgcccggtcctatgccctgagcctgcggatcaccaccgccatc
gccaacgaattcggcgctcacggctga

DBGET integrated database retrieval system