KEGG   Novosphingobium sp. PP1Y: PP1Y_AT9150Help
Entry
PP1Y_AT9150       CDS       T01515                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PP1Y_AT9150
Enzymes [BR:npp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PP1Y_AT9150
Transporters [BR:npp02000]
 Other Transporters
  Pores ion channels [TC:1]
   PP1Y_AT9150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_N_4 GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CCA91855
UniProt: F6IK37
LinkDB All DBs
Position
981629..982300
Genome map
AA seq 223 aa AA seqDB search
MWHIFQFPLCPFSRKVRLLMAEKGIAYELQSARPWENEDRLFAMNPAGRTPVIKETDRNI
VLCDSRAICEYFEETVDRNPLISGTAQQRAEIRRLIAMFDESFFNDVSGPLLHERMKKRL
VLRQSPDAKMLREAMKLAHDYLDYIDFLIDHRPWLAGSTMTLADLTAAAQISVADYLGGI
DWSSHEQSRGWYLVMKSRPSFRPLLSERMEVIQPPSHYAEVDA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacatcttccagtttccgctctgccccttcagccgcaaggtcaggctgctcatg
gcggaaaaaggcattgcctacgaactgcagtcagcccgcccctgggagaacgaagaccgc
ctcttcgcgatgaacccggccggacgcacgcccgtgatcaaggaaaccgatcgcaacatc
gtgctctgcgacagccgcgccatctgcgagtatttcgaggagacggtcgaccgtaatccg
ctgatcagcggcacggcccagcagcgcgccgagatccgccgcttgatcgcgatgttcgat
gagagcttcttcaacgacgtctccggtccgctgttgcatgagcggatgaagaagcgcctc
gtcctgcgccagtcgcctgacgccaagatgctgcgcgaggccatgaagctggcgcacgac
tatctcgactacatcgatttcctgatcgaccaccggccctggctcgccggctcgacgatg
acgctggccgacctgaccgcggccgcgcagatctccgttgccgactatctcggtggtatc
gactggtcgagccacgagcaatcgcgcggctggtatctcgtgatgaagtcgcgtcccagc
ttccgtccgctgctcagcgagcgcatggaagtcatccagccgccaagtcactacgccgaa
gtggatgcctga

DBGET integrated database retrieval system