KEGG   Novosphingobium sp. PP1Y: PP1Y_AT9967
Entry
PP1Y_AT9967       CDS       T01515                                 

Definition
(GenBank) nitrite reductase (NAD(P)H) large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00910  Nitrogen metabolism
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PP1Y_AT9967
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     PP1Y_AT9967
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Rubredoxin_C Pyr_redox NIR_SIR_ferr DAO GIDA AlaDh_PNT_C Pyr_redox_3 NAD_binding_8 NAD_binding_9 GMC_oxred_N FAD_binding_2 3HCDH_N FAD_binding_3
Other DBs
NCBI-ProteinID: CCA91929
UniProt: F6IKB1
LinkDB
Position
1072794..1075301
AA seq 835 aa
MNFEKGDLPGQGRERLVVIGNGMAGCRAVEEILARDPKRFDITIFGAEPRVNYNRIMLSP
VLAGEKTFDEIVINTQQWYDDNGITLISGDRVDHIDREAMTVISASGRAEPYDRLLIATG
SDPFIIPVPGKDLEGVVTFRDLDDVDKMLGAAEAGNARGGGNAVVIGGGLLGLEAAHGLS
LRGMKVTVIHLMPTLMERQLDEAAGWLLKTELERRGQTILTGANTREILGKDDKVAGVML
DDGTEIPADIVVMAVGIRPATGLARAAGLEVERGIMVDDHMVTSDPAILSVGECVQHRGM
CYGLVAPLWDMCRALADFVTESPTGYEGSVTSTKLKVSGIDLFSAGDFSGGEDCEDIVMR
DASRGVYKRVIVKDNKVLGAVLYGDTADGSWYFDLMKKGEDVSEIREALIFGQAFASGGA
LADPNAAVAALSDDAEICGCNGVSKGAVVQCITGGAHSLDAVRSGCKASASCGSCTGLVE
SLLAVTLGGEVESGPKTMCKCTSFTHDDVRKLIVEKQLKVIPEVMQELHWTTPDGCASCR
PALNYYLLCAWPGEYEDDQKSRFVNERLHANIQKDGTYSVVPRMWGGLTNPTELRAIADV
VEKYNAPMVKVTGGQRLDIFGIKKEDLPAVWADLNAAGMVSGHAYGKSLRTVKTCVGSEW
CRFGTQDSTGLGVKIERMTWGSWMPHKFKIAVSGCPRNCAEATIKDFGVVCVDSGYELHI
AGNGGIKVRATDLLCKVDSEEDALEMCAAFIQLYREEAHYLERTAPWVERVGLEYVKDKL
AEDGAVRTYAARFLYSQQFMQDDPWAKRAAGDRKDLHAHIATVRPLDMALELEKA
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgaacttcgagaagggcgaccttcccggccagggccgggaaaggctcgtggtgatcggc
aacggcatggcgggttgccgcgccgtcgaggaaatcctggcgcgcgatccgaagcgcttc
gacatcaccattttcggcgccgagccgcgggtgaactacaatcgcatcatgctttctccg
gttctggccggtgagaagaccttcgacgaaatcgtcatcaatacccagcaatggtacgac
gataacggcatcacgctgatctcgggcgacagggtcgatcacatcgaccgcgaggcgatg
acggtgatttccgcgtccggccgcgccgaaccttacgacaggctgctgatcgccaccggc
tccgatcccttcatcattcccgtaccgggcaaggacctcgaaggcgtcgtcactttccgc
gacctcgatgacgtcgacaagatgctcggcgcggccgaagccggcaacgccaggggcggc
ggcaatgccgtcgtcatcggcggcggcctgctcggcctcgaagcggcccacggcctctcg
ctgcgcgggatgaaggtcacggtcatccacctcatgcccacgctgatggaacgccagctc
gacgaggcagccggctggctgctcaagaccgagctggagcgtcgtggccagaccatcctg
accggtgcgaataccagggaaatcctcggcaaggacgacaaggtcgccggggtcatgctg
gatgacggcaccgagatcccggccgacatcgtcgtcatggccgtcggcatccgcccggcc
accggccttgcccgcgccgccggcctcgaggtcgagcgcggcattatggtcgacgaccac
atggtcacgtccgatccggcgatcctctccgtgggcgaatgcgtccagcaccgcggcatg
tgctacggcctcgtcgcgccgctctgggacatgtgccgtgccctggccgacttcgttacc
gagagcccgaccggctatgaaggctcggttacgtcgaccaagctgaaagtctcgggcatc
gacctgttctcggccggggatttctccggcggcgaggactgcgaggacatcgtcatgcgc
gatgcttcgcgcggggtgtacaagcgcgtcatcgtcaaggacaacaaggtcctgggcgca
gtgctctatggcgatactgccgacggctcctggtacttcgacctgatgaagaagggcgag
gacgtttccgaaatccgtgaggccctgatcttcggccaggccttcgcgtccgggggtgcg
ctcgcggaccctaacgccgccgttgctgccctctcggacgatgccgagatctgcggctgc
aacggcgtttccaagggcgccgtcgtccagtgcatcaccggcggggcacactcgctcgat
gccgtgcgcagcggctgcaaggcctcggcctcctgcggttcgtgcacgggcctcgtcgaa
agcctgctggcggtgacgctgggcggcgaagtcgagagcggcccgaagacgatgtgcaag
tgcaccagctttacccatgacgacgtacgcaagctgatcgtggagaagcagctcaaggtc
attcccgaggtcatgcaggaactgcactggaccacgccggacggctgcgcctcgtgccgc
cccgcgctcaattactatctgctctgcgcgtggccgggcgaatacgaagacgaccagaag
agccgcttcgtcaatgaacgccttcacgccaatatccagaaggacggcacttactcggtc
gtcccgcgcatgtggggcgggcttaccaaccccaccgaactgcgtgcgattgccgatgtc
gtcgagaagtacaacgcgccgatggtcaaggtgaccggcggacagcgcctcgacattttc
ggcatcaagaaggaagacctgcctgccgtctgggccgacctcaatgccgccggcatggtc
tcgggccacgcctacggcaagtcgctgcgcacggtgaagacctgcgtcggctccgaatgg
tgccgcttcggcacgcaggattcgaccgggcttggcgtcaagatcgagaggatgacctgg
ggctcgtggatgccccacaagttcaagatcgccgtcagcggttgcccgcgcaattgcgcc
gaggcgacgatcaaggacttcggggtcgtctgcgtcgactccggctacgaactgcacatc
gccggcaacggcggcatcaaggtccgcgcgaccgacctgctctgcaaggtcgatagcgag
gaagatgcgctcgagatgtgcgctgccttcattcagctctaccgggaggaagcacattat
ctcgagcgcacagctccctgggtcgaacgggtcgggctggaatacgtgaaggacaagctg
gctgaagatggcgcggtccggacctacgctgcccggttcctctattcgcagcaattcatg
caggacgatccctgggccaagcgggccgcgggagaccgaaaggacctgcacgcccacatc
gccaccgtgcgtccgctggacatggccctggaactggagaaggcataa

DBGET integrated database retrieval system