KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl6357Help
Entry
PP1Y_Mpl6357      CDS       T01515                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
npp  Novosphingobium sp. PP1Y
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCA90531
UniProt: F6IE06
LinkDB All DBs
Position
Mpl:638934..640403
Genome map
AA seq 489 aa AA seqDB search
MVPENIRIAHPDKLYIGGEWVESSGDRVLELVSPDSEAVIARVVEGTEQDMDRAVEAARK
AFDQGPWSSMPPAERSALVRRMGAELEKREPELASAWTAQVGGLASFAPIMTGGATATFM
AIAGYGDEYQFVEKRQGQQVDTAVIVREPAGVCAAIAPWNAPYGILSSKVAYALVAGCTV
IMKPSPETPLEAYIMAEAAEAAGFPPGVVNLVAAGREASDHLVRNPGVDKVTFTGSTLAG
KRIGEVCAGRVARCTLELGGKSAAIIRDDFPIEAAAALLGNTITIMSGQVCAMLSRAIVP
RRRHDELADAIAKVMREIRIGHSEDPETQLGPLAMKRQLDRVEHYIELGRDTADLVTGGT
RPVSMNKGFFMEPTLFANVDNRSRIAQEEIFGPVLCLIPADDEEDAIRIANESDYGLNGS
VLTHDVDAAYRIARRMRSGAFGQNGMKMEFGLPFGGFKQSGIGREGGPEGLNAFVETKTI
LLDGAPSSL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtccctgaaaacattcggatcgcacaccccgacaaactctacattggcggcgaatgg
gtcgaatctagcggtgatcgtgtgctcgaactggtctcacccgacagcgaggcggtgatc
gcgcgcgtggtcgaggggaccgaacaggacatggatcgcgcggtggaggctgcgcgcaag
gccttcgatcagggtccgtggtcctcgatgccgcctgcagaacgttccgctctcgtgcgc
aggatgggagccgagctggaaaagcgcgaacccgaactggcttcggcctggaccgcgcag
gtgggggggcttgccagcttcgctcccatcatgaccggcggcgcgaccgccactttcatg
gctatcgccggctacggcgatgagtaccagtttgtcgagaagcgccagggccagcaagtc
gacacggccgttatcgtgcgcgaaccggccggcgtttgcgccgccattgcgccctggaac
gcgccttacggcattctctcctcgaaagtcgcctatgcgctggtggccggttgtacggtg
atcatgaaaccgtctccggaaacgccgctcgaagcttacatcatggccgaggccgccgaa
gcagcgggctttccgccgggagtcgtcaacctcgtcgctgccggtcgcgaggcgtccgat
cacctggtgcgcaatccgggggtcgacaaggtgacctttaccggctcgacgctggcgggc
aagcggatcggcgaagtctgcgcgggccgcgtggcgcgctgcacgctggaactgggcggc
aaatccgcggcgatcatccgcgacgacttcccgatcgaggccgccgccgcgctgctgggc
aacacgatcacgatcatgagcgggcaggtctgcgcgatgttgagccgcgccatcgtcccg
cgccgccgtcacgatgagctggcggacgcgatcgccaaggtcatgcgcgagatccgcatc
ggccacagcgaggatccggagacccagcttggcccgctggcaatgaagcgccagctcgac
cgcgtcgagcattacatcgaactgggtcgcgatacggccgacctggtgacgggaggtacc
cgtcccgtgtcgatgaacaagggcttcttcatggagccgaccctcttcgccaacgtcgac
aaccgcagccgcatcgcccaagaggaaatcttcgggccggtcttgtgcctgatcccggca
gacgacgaggaagacgcgatccggattgccaacgaaagcgattacggcctcaacggttcg
gtgctgactcacgacgtggatgcggcgtaccgcatcgcccggcgcatgcgcagcggggct
ttcggccagaatggcatgaagatggagttcggcctgccattcggcggtttcaagcagtcc
ggtatcggccgcgaaggtgggccggaaggtttgaacgccttcgtcgaaaccaagaccatc
ttgctcgacggagcgccctccagcctctga

DBGET integrated database retrieval system