KEGG   Nanorana parkeri: 108783740
Entry
108783740         CDS       T04897                                 

Gene name
NSD1
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
  KO
K15588  [histone H3]-lysine36 N-dimethyltransferase NSD1 [EC:2.1.1.357]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108783740 (NSD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108783740 (NSD1)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     108783740 (NSD1)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108783740 (NSD1)
SSDB
Motif
Pfam: PWWP SET C5HCH AWS PHD PHD_2 zf-HC5HC2H_2
Other DBs
NCBI-GeneID: 108783740
NCBI-ProteinID: XP_018407886
LinkDB
Position
Unknown
AA seq 2397 aa
MDEACDLDRLGSGRLTYFNSLDPNAQHKRYAVDRSMLEPVNGCPVPRNQLPQTNPQGYSQ
ESSSDYNPLRRLQDIASMMNMDGVNGSHNRDRRASEPSPQPYFYNQSEPPIHPTGADPSR
HYTPDIPLKSCKPLKNGMHPFNTFCHVEPEYNMEHLNYGLEESGFGMHLPVYRQHPPALE
NIGAATSKISAPPDFGADLEDLVQLDWANDGENQMENKPLPRKTSFLAMIQDSEISNGTH
SSTISDTLLDGGMEESPPSQVDNRLSGQGPLSIISPEEKSLSLEDELEDFDTSHELSPNS
SELQRHPRRKKAASVVYEEGDIVWAKFSRRPWWPCKICAIPPQEEKGASTTKSPRRYYVE
TLGELTEKIWVTAKAVVPFKGVYQFEELPDSKPSPKEGCSKPKIPSKLLPLWQSSIAHAQ
DFLAKTEYGDVVQFASPTDQQPHYGGKNFTGTIGVLNGFVKSHLPNSVPSPCTNTDSVKK
KHGISRKPLNKNSPKTKHLGEDYVASKQAVSPDSWSNETSDEKIKMPPSQRESSDLKQVF
NDPHSLRERSNSTGLLEQDKCLMDKQFQSDHAESAKSLNKPAVSSTTDILKNELDTLNQF
PIQSAGSEVEISAGNIKNKKRVRDCSLSSLISANKKPSRSKDYSDCSKEMSPNKLAAPES
PGESQKPILANHTIGKGRHSLNNLTRPLNVASQSCTAGENLHEHCSKDSKNSPKSPIRPG
RTEMSYELNERSSDPLEKEQPSRISSDHAENTTSKPSTPLLFPSAPDQSRIPMEPDYKYS
NLLMKLKDLHDTKAKERKLMTGKNTSSVCSPTQCSSESGSDKVHKPAVEGGLKQELENAS
ADAKDSSFAQSGAQNPCSSTSKLDGLVNITTVPRPNKRFTKPCILQKRRARTTEDVNTND
KTASRKESMSSECVDQPLVGRSPDGAKLGTSPNSNASSQNDTLIKENMETVSSNSFAQSN
SQNDAQTCQSGTTEMIPCGKDTEADSRLNRVNSGSVEPDDNCLAPKKRWQKFDRASEENY
SEGSLKDCTPPPTNLSDKSKAPSLSVTAQHDPPRRGANWSKKYKRSRKRGRNCADEHWTS
GAPKKRNCRQPAASSQHELTKEKAKLGHPNKTWSEPADKSTKLSHSSGDSKDGKFSRMAS
QVTIKTEPIEESDCCTTPSPVKPANCGNRRKSKLIPRVCDFDDLDAQLGIKEEEEEEEAI
FPKAKPAIALSLKKPLKRIRYRKASSRLTEKRKKKKKRLRLASKIKKEKNLSSRESSHSE
GESNDMGAASPSDTAEEGLDQDHGGPSKKNFERGGGGAAMKENVCQVCEKPGELLLCEAQ
CCGAFHLHCLGLSGMPRGKFICSECSSGVHSCFVCKTSDSEVKRCSLALCGKYYHENCAF
NYPPTLQLNKGFRCSLHVCTTCHANNPSHPSASKGRLMRCARCPVAYHANDFCVAAGTVT
LASNSIICPNHFTPRRGCKNHEHINVSWCFVCSEGGSLLCCESCPAAFHRECLNIEMPEG
NWFCNDCKAGKKPHYKEVVWVKVGRYRWWPAEVCNPKSIPTNIQKMKHDIGEFPVLFFGS
KDYLWTHQARVFPYMEGDALNKDKMSKGVDAVYKKGLMEAAERFEELKAQKEMRQLQEEK
KNDKKPPPYKHIKVNRPIGKVQILTADLSEIPRCNCKETDDHPCGQDSECINRMLLYECH
PSVCPAGEHCQNQAFSKRQYPQVEIFRTLSRGWGLHCKTDIKKGEFVNEYVGEMIDEEEC
RARIRYAQEHDIINFYMLTLDKDRIIDAGPKGNFARFMNHCCQPNCETQKWTVNGDTRVG
LFALCDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPVSEDRARRKYVK
RTKNEVVKEHEDECFSCGDGGQLVSCKKTGCPKVYHADCLSLTRRPAGKWECPWHQCDIC
NKEAASFCEMCPSSFCKIHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEVREPDSSSSR
KSDPIQPPSATKAAADSPKEKSPSSIDKKSKLTKVLLSPSLTGPQESLFLALGENAKPTG
KVLVGCSDKMSLSAGKILLTTAGQKSSTGRKLILASTAQKSLPPGKVLLASLGKKSLTTG
KLLLASIGNKSLSSGKVLLTPVGKNSSPVGRVLLSSTGKHAGKVMLASAGKLTAEAGKVL
LTASVKHQAVTGKPVLVDGKVLAGKSDHVKEGKLESQSSSAPQPRRTPPLDTSVDKCNAP
LKKKFTLITLKQPKHPCQKVTIDLTKERPGHVNHHNGSNGKAQSKTSSQRSHNHTSQEEP
STPEGTLSMAKTGDRSESSEHLKKPVNCSQTSATTSKDQTRIAKEGPHSVSGKTSMPAPY
NSSEEKSLPSIDCINETSLSDQEEAGVSGEQKLATKCKVQNPSNASQGLVCSAPENQ
NT seq 7194 nt   +upstreamnt  +downstreamnt
atggatgaagcctgtgatctagacaggctcggcagtggccgcctgacctattttaactcc
ttggatccaaatgcccagcacaaacggtacgcggtggatcgaagtatgctggagccagtg
aacgggtgcccagtgccgcgcaatcagctgccgcagactaacccgcagggttatagtcaa
gaatcttcttccgattacaatccgctgcggcggctccaagacatcgcctccatgatgaat
atggacggcgtgaacggatcgcacaatagggacaggcgagcgtccgaaccgagtccgcag
ccttacttttataatcagagcgaaccaccaattcatcccacaggagcagatccttcacgc
cactatacaccagacattcctttgaaatcctgtaaacctttaaaaaatggaatgcacccc
tttaatacgttttgtcatgtggaaccagaatataacatggaacatctaaattacggactg
gaggaatctggctttggtatgcatttgcctgtttacagacaacaccccccggcattggaa
aatattggggcggctacatcaaaaataagtgcacctccagactttggagcagatttggag
gatttggtccagctagattgggctaacgatggtgaaaatcaaatggaaaataaacctctt
ccgagaaaaacgtctttcttagcaatgatccaagattctgaaatatcaaatggaacccac
tcaagtacaatttcagacactcttttagatggtggaatggaagaaagtccaccatcacag
gtggataatagactaagcgggcaagggcccctttccataataagtccagaagaaaagtcc
ttgtctctggaagatgagctggaagattttgatactagtcatgaactttctccaaactcc
tcggaattacaacgacacccgaggaggaaaaaagctgcttctgtagtctatgaagaaggg
gacattgtgtgggcaaagttcagtcgacgcccttggtggccatgtaagatctgtgctata
cctcctcaggaagaaaaaggtgcatctactacaaagtcaccacgacgatattatgtggaa
accttgggggaactaacggagaagatttgggtgaccgcaaaagcagttgttccattcaaa
ggtgtttatcagtttgaagaattacccgattcaaaaccgtctccaaaggaaggttgtagc
aaaccgaagattccatcaaaacttcttccactgtggcagtcaagtattgctcatgcccag
gatttccttgccaagacagagtatggggatgttgtacagtttgcaagtccaacagaccaa
cagccacattatggtggaaagaatttcactggaacaatcggtgtattgaatggttttgta
aaatctcacctgcccaacagtgtcccttctccttgcactaacactgattctgtaaagaaa
aaacatggtataagccgaaagcctttaaataagaactctcctaagaccaaacacttaggg
gaagactatgttgcctctaagcaagctgtctctcctgattcttggtctaatgagaccagt
gatgaaaagattaaaatgccaccatctcagagagaaagtagtgatctcaaacaagtattt
aatgatcctcatagccttagagaaagaagcaacagtactggactactggagcaagacaaa
tgtttaatggacaagcagtttcagagtgatcatgctgaatctgccaagtctttaaataaa
ccagctgtgtcttcaacaacagatatacttaaaaatgaactagacacccttaatcaattt
ccaatacaaagtgctggctcagaagtggagatttctgcaggaaatataaaaaacaagaaa
cgcgttagagattgttcattatccagccttataagtgctaataagaaaccttccagatcc
aaagactattcagactgcagcaaagagatgtcgccaaataaattggctgcaccagagtct
cctggggaatcccaaaaaccaatattggcaaatcatacaatcggcaaaggtcgccattct
ctgaataatttgactaggcctctaaatgttgcaagccagtcctgcacagcaggtgaaaac
ttgcatgaacattgcagtaaggactccaaaaattctcctaaatcgcctattaggcctggg
cgcacagaaatgtcctatgaattgaatgaaaggtctagtgatcctttagagaaggagcag
cccagtaggataagcagtgatcatgctgaaaacacaacctcaaaaccttcaacgcccttg
ctcttcccgtctgctcctgatcaaagtagaattcctatggagcctgactataaatacagc
aacctgctgatgaagcttaaagatcttcatgataccaaagcgaaggaaagaaagctcatg
actggaaaaaacacctcttcggtgtgtagccctacacaatgttcttctgaaagtggctca
gataaggtacacaagccagcagtagagggtggactgaagcaagagcttgaaaatgccagt
gctgatgcaaaggatagttcttttgctcagtctggtgcacaaaacccctgtagctcgaca
agcaaattggatgggttggtaaatattactacagtacctcgtccaaacaaaagatttaca
aagccctgcattctgcagaagagacgagctaggacaacagaagatgtgaatacaaatgac
aaaactgcttctcggaaagagagtatgtcttcagaatgcgtggaccaacctttggtagga
aggagtcctgatggggcaaagctgggcacttctcccaacagtaatgcatcgtctcagaat
gacacactaataaaagaaaatatggaaactgtatcaagtaattcttttgcacagtcaaat
tctcaaaatgatgcacaaacctgccaaagcggcacaactgaaatgattccttgtggcaag
gatactgaagcagattcaagacttaacagagtgaactcgggttcggttgagccagatgat
aattgtctcgcgcccaaaaaacgctggcagaagtttgaccgtgctagtgaagaaaactac
agtgaaggttctttgaaggattgcactccgccacccactaatctgagtgacaaaagcaaa
gctccaagcctttctgtcacagcacaacatgacccaccacgacgaggagctaactggagt
aagaaatacaagagatctagaaaaagaggcaggaactgtgcagatgaacactggacgtcc
ggtgccccaaagaaaaggaactgcagacagcctgcagcttcttcacagcatgaactcacc
aaagagaaagccaagctgggtcaccctaataaaacatggagtgagcctgctgataagagc
actaaactttcacactcaagtggagattcgaaagatggcaagttttctagaatggctagc
caagttaccataaaaacggaacctattgaggaatcggattgctgcactactccttctcca
gtcaagccagcaaactgtggaaatagacgcaaaagtaaacttattccaagagtgtgtgac
tttgatgacctggatgctcaacttggcattaaagaggaagaggaggaggaggaggcaatt
ttccctaaagctaagcctgccattgctctatcactgaagaaacctctgaaacgtatccgg
taccgaaaagcaagcagtaggctcactgaaaaacggaagaagaagaagaaacggttaaga
cttgctagcaaaatcaagaaggaaaagaatctgtcctctcgggaatcttctcattctgag
ggtgaaagtaatgatatgggtgcagctagtccaagtgacactgctgaggagggactagat
caagatcatggaggaccttctaagaagaactttgaacgaggtggaggtggagcagccatg
aaagagaatgtgtgccaggtctgtgagaagccaggggaactgctgctgtgcgaggcccag
tgttgtggagcatttcacttgcactgccttggactgagtggcatgcctcggggaaagttc
atctgtagtgagtgctcttcaggtgtccattcatgctttgtgtgcaagacctctgattca
gaggtgaaacgctgctctctagctctgtgtgggaagtattatcatgagaactgtgctttc
aattatcctcccaccttacagctgaataaaggcttccgctgttccctgcatgtctgcacc
acctgccatgccaacaatcccagccatccctcagcttctaaaggtcgattgatgagatgc
gcccgttgcccggttgcctatcatgccaatgatttctgtgtggcagcaggaacggttacc
cttgcttctaacagcattatttgccctaaccactttactccacgtagaggatgcaaaaac
cacgagcatatcaatgttagctggtgctttgtgtgctctgagggtggaagtctcctttgt
tgtgaatcttgtccagctgcttttcatcgtgagtgtcttaacatcgaaatgccagaggga
aattggttctgcaatgactgtaaagctggcaaaaaacctcattataaggaagtggtgtgg
gtgaaggttgggagatacagatggtggccagctgaggtttgtaatccgaagagcattcct
acaaacatccaaaagatgaagcatgatattggagagtttcccgttttgtttttcgggtca
aaggactatttgtggacccaccaggctagagtctttccatatatggaaggagatgccctc
aacaaagataaaatgagcaaaggagtggatgctgtctacaaaaaggggctaatggaagct
gcagagaggtttgaagaactgaaagcacagaaagaaatgagacagctgcaagaggaaaag
aaaaatgacaaaaagcctccaccctataagcacattaaagtaaacaggccaattgggaag
gttcagatcttaacagctgatttgtcagaaatccctcgttgcaactgcaaggaaacagat
gatcacccatgtgggcaggactctgaatgcattaaccgcatgctgctatatgaatgccat
ccttcagtttgcccagctggcgaacactgccagaatcaggccttctccaaacgtcagtac
ccacaagtggagatcttccgaactctgagccggggctggggattacactgcaaaaccgat
ataaaaaagggtgaatttgttaatgaatatgtgggcgagatgattgatgaagaggaatgt
cgagctcgcatccgctatgctcaggaacatgatatcataaatttctacatgctaactcta
gacaaggaccgtatcattgatgctgggccaaagggaaattttgcacgcttcatgaaccac
tgctgccagccaaactgcgagactcaaaaatggaccgttaatggtgacactcgagtggga
ctttttgccttgtgtgacattaaagctggaacagaattaacattcaactataacttggag
tgtctcggaaatggaaagacagtgtgtaaatgtggtgcaccaaactgcagtggttttcta
ggagtcaggcctaagaaccagccagtgtctgaagaccgggccaggaggaagtatgtgaag
cgaacaaagaatgaggtggtaaaggagcatgaagatgaatgttttagctgtggagatgga
ggacagcttgtttcatgcaaaaaaacaggttgccccaaggtttatcatgctgactgctta
agtttaacacgtagacctgctggaaagtgggaatgtccatggcatcagtgtgacatttgt
aacaaggaggcagcttccttctgtgagatgtgccccagctccttttgcaaaattcaccgt
gagggaatgctcttcatctccaagcttgatggaagattatcctgcactgagcatgaccca
tgtgggcctaatcctttggagccaggtgaagttcgtgagccagactcctcttctagcaga
aagagtgatccgatccagccaccttctgccacaaaagctgcagcggacagtcccaaggag
aagtctccttcgtcaatcgacaagaaaagcaaactaacgaaagtgttgctgagtccgtct
ttaactggtcctcaagaatctctattcctggctctaggggaaaatgcaaagcctactgga
aaggttttagttgggtgttcagataaaatgtctttgtctgctggcaaaatacttttgacc
actgcagggcagaagtcttccactggtagaaagttgattctggcctccactgcacagaag
tcattgcctcctggaaaggtgttgttggcatctttggggaagaaatctctaactactggg
aagcttttgttggcctctataggaaacaaaagtctatcttctgggaaggtactgctaacc
cctgttggaaagaactcttcaccagttggtcgagtgctgctatcttctacaggaaaacat
gcagggaaagttatgttggcttcagctggaaagctaacagcagaggcggggaaggtgctc
ttgactgcttctgtaaaacaccaggctgttacagggaaacctgttttagttgatggaaaa
gttctagctggcaaatctgatcatgtaaaagaaggcaagcttgagtcacaatctagcagt
gcacctcaacctcgtaggacaccaccccttgatacctctgtagataaatgtaatgctcct
ttgaagaaaaaatttactctaatcacacttaaacagccaaaacatccctgccaaaaagtg
accattgatttaacgaaagagaggcctggacatgttaatcatcacaatggctcaaatggc
aaagcgcagtctaagacttcttcccagagatcacacaaccatacatctcaggaggaacca
agcacccctgaaggaacattgtctatggcaaaaacaggagatagatctgagagctcagag
cacctgaagaaacctgtaaattgttcacaaacatcagccactacttctaaagaccaaact
aggatcgccaaagaggggcctcattctgtatctggtaaaacttccatgccagcaccctac
aacagctcagaagagaaatctttgccatctatagactgcatcaatgaaacatctctctct
gatcaagaagaggcaggtgtttctggtgagcagaaacttgctacaaagtgcaaggtgcaa
aacccttctaacgcctcacaaggtcttgtgtgctctgcacctgaaaaccagtga

DBGET integrated database retrieval system