KEGG   Nanorana parkeri: 108783805
Entry
108783805         CDS       T04897                                 

Gene name
SMYD2
Definition
(RefSeq) LOW QUALITY PROTEIN: N-lysine methyltransferase SMYD2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108783805 (SMYD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108783805 (SMYD2)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108783805 (SMYD2)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     108783805 (SMYD2)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108783805 (SMYD2)
SSDB
Motif
Pfam: SET zf-MYND TPR_12 TPR_8 CBP_BcsR
Other DBs
NCBI-GeneID: 108783805
NCBI-ProteinID: XP_018408007
LinkDB
Position
Unknown
AA seq 438 aa
MGPSEGIERFVSPGKGRGMQALRHFGLGELLFTCPAYTSVLTSNERGNHCEHCFNRKEGL
AKCGKCKQAFYCNVDCQKGDWPMHKLECSAMCAYGEKWNPSETVRLTARILAKQQIHFNC
SISHLTXLVLXCEKLXLCFFLSADFSKLDNEKRELIQNDIAALHHFYSKNMNYSDASLEL
LFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYRGTVAEVRAVREINPGD
EVFTSYIDLLYPTEDRNDRLQDSYFFTCECRECTTKEKDAAKLEMRKLNDPPCPKDVRDM
IKYGRGVVEEFRRAKHFKSPSELLEMCELSMEKMGTLFADNNIYMLHMTYQSMGICLYMQ
DWEGALKYGEKIIHPYRKHYPAYSLNVASMWLKLGRLYMGLEKKTAGIKALKKAINVMEI
AHGPDHHYIAEIKKEMEQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggaccctcagaaggcatcgagcgattcgtcagcccggggaaaggccgaggcatgcag
gccttgcggcactttggtctgggggagctgttgttcacctgcccggcctacacctcagta
ctgacttccaacgagcgaggcaaccactgtgagcactgcttcaacaggaaggaaggtctt
gcaaaatgcggcaaatgcaaacaggccttctactgcaatgtggattgccagaaaggagac
tggcccatgcacaaactggagtgttccgccatgtgtgcttatggagagaaatggaatcct
tcggaaactgtaagactgaccgcaaggattctggccaaacagcaaatacattttaactgt
tccatcagccatttgacttgacttgtgctttaatgtgaaaagctgtagctctgtttcttt
ctttccgcagactttagcaagctggacaatgagaagagagagctcatccagaatgatatt
gcagccttgcaccatttctactccaaaaatatgaactattctgatgcttcactagaactc
ctctttgcacaggttaactgtaatggctttaccattgaagacgaggagctgtctcactta
ggatcagctattttccccgacgtcgctctaatgaaccacagctgctgtcccaatgtaatt
gtcacttacaggggcaccgtcgccgaggtccgagctgtgcgagagattaaccctggggac
gaggtgttcaccagctacatcgatctactctaccccacagaagatcggaatgacagactg
caagattcctacttcttcacttgtgagtgcagggagtgcacaacaaaagagaaggatgcg
gcaaagctggagatgaggaaactcaatgacccaccctgtcctaaggatgttcgagacatg
atcaaatatggccgcggtgtggtggaagagttcaggagagccaagcacttcaaaagtcct
agtgaactgctggagatgtgtgagctcagtatggagaagatggggacgttatttgcagac
aataacatttatatgttacatatgacgtatcagtccatgggaatctgcctgtacatgcag
gactgggaaggcgccttaaagtatggagagaaaatcatccacccgtaccgtaagcactat
cctgcatactctctgaatgttgcctccatgtggctgaagttggggagactttacatgggc
ctggagaagaagaccgctggaattaaggccctaaaaaaggccatcaatgtcatggagata
gctcatggacccgatcaccattatatagccgagatcaagaaagagatggagcaataa

DBGET integrated database retrieval system