KEGG   Nanorana parkeri: 108783946
Entry
108783946         CDS       T04897                                 

Gene name
PRDM2
Definition
(RefSeq) PR domain zinc finger protein 2 isoform X1
  KO
K11432  [histone H3]-lysine9 N-trimethyltransferase PRDM2 [EC:2.1.1.355]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108783946 (PRDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108783946 (PRDM2)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     108783946 (PRDM2)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108783946 (PRDM2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_6 SET zf-H2C2_2 zf-C2H2_11 zf-C2HE zf-C2H2_jaz
Other DBs
NCBI-GeneID: 108783946
NCBI-ProteinID: XP_018408164
LinkDB
Position
Unknown
AA seq 1619 aa
MNQDAIKYQEAAESLADVPEHVLRGLPEEVTLCPSSVDKLRLGVWSRKPLPRGKKFGPFV
GEKKKRSQVKNNVYMWEVYYPNLGWMCVDATDPHKGNWLRYINWARSAKEQNLCPLEINR
AIYYKTLKPIEPGEELLVWYNGEDNPEIAAAIEEERAASHRSKKNSPKSRRGRRRSFHGK
KKLNQNKEDKKSSPEVGSFEMKDSSDAPNEDDTKPLGSPVLSLEQTAVIQEMVNQNVLPE
TISITASELHKLPDNRGVEDATTDLELADDLQRESSERDSINQEEESPEMLDDLRSTSDE
TPEGSPKKKSLKISKPKLDVNGELPEGSMFPCQHCERKFTTKQGLERHMHIHISTINHAF
KCRYCGKAFGTQINRRRHERRHEAGPKRKTLMVSCSSELGQSHKHIIDSLKSSDEYSSSR
LQCKMTDSDRETSHSVLSEENGESSRELHPCKYCKKVFGTHTNVRRHQRRVHERHLIPKG
VRRKGHLLEDPHLKSEQSPQVENIYVASTEMEDEGEADDVYIMDITNNISENLTYFIDGK
IPSCSTNTSCDALEVEASTTDVLGINCLLTPIKVEVSQNIRPLQTATDNANPVSDSSCSG
ISEPKRRRTVSPPLLTKIKTEVDLEAVTPSCSLSIPLTVSVSDNLPFQKEKHFYLSSKLK
QLLQTQESNKSPVSPSLLSEIPKLSPAVSSIPTAPNRFKRRTASPPSSPQHSPAPKEFVK
QGEGKTSWNEGLGTKIPKVESHNSSPACSLSGREERENLSPCCEDLKVTKEWTPNISFGN
VCNQQPLDLSSGVKQKCESKSRSQVPWESVLDLSINRKPVCDAEGKDYKGNNLCIGVKKK
KPTTCMLKKVLLNEYDDLEVPGETASQPDADLLSCRTDGGELLPELVAGSSGDIAFSPED
ASPTPVESTCTPVCQSPPVLTPSEAPSPSLCTTFVMDITSPPPLLTTNVPSLPESSCSVP
PTPSCPSPLSVSTQSPLPVLSRTASPTPSLSPTTDDPSGCASPGPPTLSSSSSSSSSSSS
CAASSSSSSCSSPPPLSVVSSIVSPSLNSESSATTFVKQEKQEDETASKDSSQSSHRDSV
SEGFNKTFVCNVCESPFVSIKDLAKHLVVHAEEWPYKCEFCVQLFKDASYLTEHRSVLHG
VGKIFVCSLCKKEFAFLCNLQQHQQDLHADKEYSHHELESGSLRPQNFTDPTKAILLQNQ
RMDEEPMTPEEDGDLNDSSEELYTTIKIMASGEKSKDPDVRMGLNQHYPSFKPPPFQYHH
KNPLGIGTTATNFTTHNIPQTFSTAIRCTKCGKGVDNLPELHKHILVCASASDKKRYTPK
KNPIPLKQTVMPKNSVGVVVLEPAENNSFRRMGQPKKLNFTLEISKMSSGKLKLGALKRK
NQLIHKAILQKNKKARQKSSLRFGMSGSSHVCPYCNREFTYIKSLDKHASFSCPKKPASP
STKKHATKPQKKATSAKKHKISIIRRTADAEIQMQTTEAHLGKTRARSVAPTAPIQLPTI
PIKTKQTVKAGPLVKSKKQNVPIVRNSSPVRISKSQAAQDGKKTKKIPLQVLPHAFGKTA
QKLHVKMQKNKMANKQLVKKKLDKFSGKSRERIGGPRTRSSTDFPDRREDGRQDSRSLY
NT seq 4860 nt   +upstreamnt  +downstreamnt
atgaatcaggatgcaataaagtaccaagaagcagccgagtcattggctgacgtgcctgaa
catgtgctgagggggcttcctgaggaagtgactctttgtccgtcttctgtggataagctg
agactcggtgtttggtccaggaagcctctcccaagagggaagaaatttggaccttttgtt
ggggagaagaagaagaggtctcaagtgaagaacaatgtgtacatgtgggaggtgtattac
ccaaacctgggctggatgtgtgttgatgccactgacccacacaaaggaaactggctgcgc
tatataaactgggctcgctcagcaaaggagcaaaacctctgccctttggagattaacagg
gcaatatactacaagaccctcaagccaattgagccaggagaggagctgctagtctggtac
aatggagaagacaacccggagatagcagctgctattgaggaagagagggctgcaagccac
cggagcaagaaaaactcacccaaatccaggaggggcaggaggagatcctttcatggtaaa
aagaaattaaatcaaaataaagaagacaagaagagcagccccgaggttggttcattcgag
atgaaggattcctcagatgctcctaatgaagatgataccaagcctctaggctcccctgtc
ctgtctctagaacaaacggctgtgattcaagaaatggtgaatcaaaatgtcctgccagag
acaatatccatcacagcttctgaactgcataaattgccagacaacaggggtgtcgaagat
gctaccactgatttggagctcgctgatgacttgcaaagggagagttcggagagagattct
attaatcaggaagaagagagtccagagatgcttgatgaccttcgaagcacatctgatgag
actcccgaaggttcaccaaagaagaagtcccttaaaatttctaaacccaaattagatgtt
aacggggagcttcctgagggttctatgtttccatgccagcattgcgaaaggaaattcacc
acgaaacaagggctagagagacacatgcacatccacatttccacaatcaaccatgcattt
aaatgccgatactgtggaaaggcatttggaacccagattaaccgcagaaggcatgagagg
cgccacgaagctggccctaaaaggaaaacattaatggtgtcatgttccagtgaacttgga
cagtctcacaaacatatcattgattctcttaaatccagtgatgaatacagcagctctaga
ctgcagtgcaaaatgacagattctgaccgagagacatcacattctgttctctctgaagaa
aatggagaatcaagccgagagcttcacccatgcaagtactgtaagaaagtgtttggaact
cacacaaacgtgaggagacaccagcgcagagttcatgaacggcatcttattccgaaggga
gtgaggcgaaaagggcatcttctggaagatccacaccttaaatcagagcagtccccacaa
gtcgaaaacatttacgtagcaagtacagaaatggaggatgaaggggaagcagatgacgtc
tacatcatggacatcaccaacaacatttctgaaaaccttacctacttcatagatggcaag
ataccatcatgtagcacaaatactagttgtgatgccctagaagtggaggcaagtacaact
gacgtcttaggaatcaattgcttgcttactccaatcaaggttgaagtttcacaaaacata
agaccactgcagactgcaactgataatgcaaatccagtaagcgactcttcctgcagtggg
atttcagaaccaaaaagaagaagaaccgtcagccctcctttgctgacaaaaataaagact
gaagttgaccttgaagcagtaactccctcctgttcgttgtcaattccattaactgtttct
gtaagcgataacttgcctttccaaaaggagaaacatttctatctgtcttcaaagcttaag
caactgctgcagacgcaggaaagcaacaagtctcctgttagtccatcattgttatcggag
atccctaagctgagcccggctgtgtcttccataccaacagcacccaacagatttaaaaga
cgcactgcttctcctccaagttccccacagcacagcccagctccaaaggaatttgttaaa
caaggagaaggaaaaacttcttggaatgaaggacttggtacaaaaataccaaaggtggaa
agtcacaacagttcacctgcctgcagtttatctggcagagaggaaagggagaacttaagt
ccttgttgtgaagatctaaaagttactaaagagtggactccaaatatatcctttggtaat
gtttgcaaccagcaacccttagacttgtccagtggagtaaaacagaaatgtgaaagcaag
agtcgctctcaggttccttgggaatctgtgcttgaccttagcattaataggaagcctgtc
tgtgatgctgaaggaaaggattacaaagggaataacttatgcattggagtcaaaaagaag
aagcctactacatgtatgttaaagaaggttctgttgaatgagtatgatgacttggaggta
cctggtgaaactgcttcgcaaccagatgcagatttactttcctgtagaacagatggagga
gaacttctaccagaactggttgctgggtcaagtggtgatattgctttttctccggaagac
gcttcccccactccagttgagagcacctgtactccagtttgccagtccccacctgttctg
actccttcggaagcaccttcaccttccctgtgtacaacatttgtgatggacattacatct
ccaccacctcttcttactactaatgttccttcactcccagaatcttcctgtagtgtacca
cccactccatcatgcccatcccctctctctgttagcacacagtctccacttccggttctt
tcgcgtacggcgtcaccaaccccttctctttcccctactactgatgatccttctggttgt
gcttcacctggtcctcctactctgtcctcctcctcgtcctcttcatcatcctcttcttcc
tgtgctgcctcatcctcttcatcatcttgttcatctcctcctcccttatctgtggtttca
tcaattgtatctccctctttaaactcggaatcctcagcaaccacatttgttaaacaagaa
aaacaagaagatgaaactgcctctaaagactcttcacagtcaagtcatcgtgactcagtt
tccgaaggttttaataagacttttgtgtgcaatgtttgtgaatccccatttgtgtctatt
aaagaccttgccaaacaccttgtggtgcacgctgaagaatggccctacaaatgtgaattt
tgtgtgcagctttttaaagatgcttcatatcttacagaacatcgctcagtgcttcatgga
gtagggaagatttttgtttgttctttatgcaaaaaggagtttgcttttctttgtaatttg
caacaacatcaacaggacttgcatgctgataaagagtatagtcatcatgaacttgaaagc
gggtctcttcggccacagaactttactgacccaacaaaggcaattttactccaaaatcaa
agaatggatgaggaacccatgactcctgaggaggatggagatttaaatgactcttctgaa
gagctgtatacaacaattaagattatggcttcaggggaaaaatcgaaagaccctgatgta
cgtatgggtcttaatcagcactaccccagtttcaaaccgccaccgtttcagtatcaccac
aagaatcccctgggtattggtacaactgcaacaaactttacaactcataatattccacag
actttctctacagctatacgttgtactaaatgtggaaagggtgttgacaatttacctgag
ttacacaaacatatattggtgtgtgcatcagctagtgataaaaaaagatacactcctaag
aaaaaccccatacccctaaaacagactgtgatgcctaaaaatagcgtaggggttgtggtt
cttgaacctgccgaaaataattcattccgaagaatgggtcaaccgaaaaagcttaatttt
accctggaaatcagtaaaatgtcttcaggcaagctcaaactgggtgcacttaaaaggaaa
aaccagctcattcacaaagcaatattacaaaagaataagaaggccaggcaaaaatcgagt
ctaagatttggcatgtctggttcttctcatgtttgtccatactgcaatcgagagtttaca
tacattaaaagtctggacaaacatgcctctttcagttgcccaaagaagccagcctctcca
tctaccaaaaaacacgctactaaaccacagaaaaaggccacctctgccaagaaacacaaa
atcagcattataagacggacagcagatgctgagatacaaatgcaaacaacagaagcacat
ttgggaaaaactagagcgaggagcgtagcacccacggctccgattcagttacccacaatt
cctattaagactaagcaaactgtaaaagctggccctctggtcaagtccaaaaagcagaac
gtgcccattgtaagaaactccagcccagtgaggatatcgaagagccaagctgctcaggat
gggaaaaaaacaaagaaaattccacttcaggtcctaccacacgcttttggcaaaacggcg
caaaagctgcatgttaaaatgcaaaagaacaagatggcaaacaagcagttggtaaagaaa
aaactggacaagttcagcggtaaatctagagaaaggattggtggacccaggacacgcagc
tcaacagacttccctgacagaagagaagatggaagacaagattctaggagcctgtattaa

DBGET integrated database retrieval system