KEGG   Nanorana parkeri: 108784114
Entry
108784114         CDS       T04897                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04137  Mitophagy - animal
npr04210  Apoptosis
npr04218  Cellular senescence
npr04620  Toll-like receptor signaling pathway
npr04621  NOD-like receptor signaling pathway
npr04622  RIG-I-like receptor signaling pathway
npr04623  Cytosolic DNA-sensing pathway
npr04625  C-type lectin receptor signaling pathway
npr04920  Adipocytokine signaling pathway
npr05132  Salmonella infection
npr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108784114 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108784114 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    108784114 (RELA)
   04218 Cellular senescence
    108784114 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108784114 (RELA)
   04621 NOD-like receptor signaling pathway
    108784114 (RELA)
   04622 RIG-I-like receptor signaling pathway
    108784114 (RELA)
   04623 Cytosolic DNA-sensing pathway
    108784114 (RELA)
   04625 C-type lectin receptor signaling pathway
    108784114 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108784114 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108784114 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108784114 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:npr03000]
    108784114 (RELA)
Transcription factors [BR:npr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108784114 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108784114
NCBI-ProteinID: XP_018408357
LinkDB
Position
Unknown
AA seq 601 aa
MSIISLRRLYVLSNYLYYDLLQEVTLKKDVTLIKHPKVFVDIRKRPGQNQHGSLRNIRNS
LLSYYILYNLSKDWIISNSSVSSSAPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTD
TTKTHPTIKVNNYQGPARIRISLVTKDAPHKPHPHELVGKDCKDGYYEADLSPDRNIHSF
QNLGIQCVKKREVEDAIAQRIRTNNNPFNVPVEDLKSDFDLNTVCLCFQICIRDPTRGLL
PFPLVVSHPIYDNRAPNTAELKICRVNKNSGTCLGGDEIFLLCDKVQKEDIEVVFALGNW
EARGSFSQADVHRQVAIVFRTPQYHDPGIRQPVKVQMQLRRPSDKEVSEPMEFQYLPDEG
DFHHIEEKRKRTLESFKHIVKNNPFAGNETKNQRRIAIPTRSIPKQEPAPSPIRPSTQMS
SLSSVSPYLLKHDEHSVSTLLSTVNISDFTSIGFSPMPPVQQPPPQPTEERIDLDYPSFT
DDGNLDLGNMLHNDPDGHCASLSSIDNSDFGQLLSQSQSSGSFSQALHESMPSQNTLMAY
PESIARLMASGSNEETCGEENSERLDSTLMNGIFDLQQGDCLRSIMDLDFTSFMTKDDYM
K
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgtctattatctcccttcggcgtctctatgttttgagcaattatttgtattatgatctc
ttgcaggaggtgacactgaagaaagatgtgactttgataaagcatccaaaggtttttgtg
gatattcggaaaaggccaggacagaaccagcatggctcgctgaggaacataagaaatagt
ttgctaagttattatatactatataatttgtcaaaagactggattatatcaaattcaagt
gtgtcgtcttctgcaccatatgtggagatcattgaacagccaaaacagcgaggtatgcgg
ttccgctataagtgcgaggggcgttctgcaggaagcattccgggagagcgaagtacggat
actacaaaaactcatcccaccataaaggtaaacaattaccaaggaccagcccgtataagg
atatctttggtaaccaaggatgccccccataaaccacaccctcatgaactggttggaaaa
gattgcaaagatggctattatgaggctgacttatcaccagatcgcaatattcacagtttc
cagaatttgggcattcagtgtgtcaaaaaaagagaagttgaggatgctattgcccagcga
atacggacaaataacaatcccttcaatgtacctgtagaagatctcaagtctgactttgac
ctgaatacagtgtgcctttgcttccaaatttgcatacgtgacccaactagaggccttctc
ccttttccattagttgtgtctcatcctatatatgacaaccgtgctcctaacactgctgag
ctgaagatttgccgagttaacaagaattctggtacctgtttaggaggagatgaaattttc
ttactttgtgataaagtgcaaaaagaagatatcgaagtggtgtttgcattgggtaactgg
gaagcacgggggtcattttcccaagctgatgtgcacagacaagtggctatagtttttaga
acacctcaatatcatgatccaggaatacgtcagcctgtaaaggtccaaatgcagttgagg
aggccatctgataaggaggttagcgaacctatggaatttcagtatctaccagatgaagga
gattttcatcacattgaggagaaaagaaaaagaacattagaaagttttaagcacattgtg
aaaaataatccgtttgcaggaaatgaaaccaagaaccagcgcaggattgctataccaaca
cgcagcattccaaaacaagaacctgcaccatcacccatccgtccaagcactcagatgtca
agtctttcttcagtgtctccgtatttgctaaagcatgatgaacattcggtgtccacactt
ctctccactgtgaatatcagtgactttaccagtattggattttctcctatgcctccggtg
caacagcctccaccacaaccaactgaagagcgtatagatttggactatccttcttttaca
gatgatggaaaccttgatttaggaaatatgctgcataatgatcctgacggccactgtgcc
agtttaagttctattgacaatagtgactttggccaacttctcagtcaatcccagtcttca
ggttctttttcacaggccctccacgaatctatgcctagtcagaataccctcatggcttat
ccggaatcaattgctcggctcatggcttctgggtctaacgaggagacttgtggagaggaa
aactctgaaagacttgacagcaccttaatgaatgggatttttgacctgcagcaaggagac
tgcttacgctccattatggatcttgactttacatctttcatgactaaagatgactacatg
aaatga

DBGET integrated database retrieval system