KEGG   Nanorana parkeri: 108784118Help
Entry
108784118         CDS       T04897                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108784118 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108784118 (KMT5B)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108784118 (KMT5B)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108784118 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 108784118
NCBI-ProteinID: XP_018408361
LinkDB All DBs
Position
Unknown
AA seq 846 aa AA seqDB search
MKWLGESKNMVVNGRRHGNRLSHEHHRSRAKLHRLGRGNLRGTKNVSDRRSSRCSGEATN
VFETQSRYVPSSGMTAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVI
EHFKKTEHLEKTFKNLISGDWSRHYFLNKNKAQEKHFKEHVFIYLRMFATSSGFSYMQKR
NDKIELLVGCIAELSEAEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCK
FVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRATGAFKSRVGLNE
PSPVINSKYGLRETDKRLNRLKKLGDGSKNSDSQSVSSNTDADTSQEKSSSCRNRKSSVG
SKKNGKSRTLTKQSLSQISVSSSTSSKLSHINNSRVPKRLRKPVKPFHSKVKMRYHCKRP
EQRNTSKNLEVGNVLLKEPKVVLYKNVAVKRDKESEGPAKLKESTGCLTRHAAREFKLNS
LKGALGESSCSYITRSSMRTRNSVEAPDAKLSPNSLDVHRSSDGGVPPLHRTDFQDQSLN
NDEFDHNTSNRQESGYQRNGLCKSRRKSRRSKHLKQAANLAVSNCDFELPGKDNTLPNLV
SSHCESDAVNAFSDGHVDYKDLRTSSDGCPVVSSEIRTKEIIRTVKSKKSRRITRYDAQL
ILENSTGIPKLTLRRRHDSNSSKAEKENDGMGSSKISIKLSKDHEKDKNSLYVAKLNNGF
NSGSGSSSTKLKIQLKREEETRRPFPEELHENGVYCKDALSLLGTRMEVNNYDHYEEESM
GDSSSEEEGEDEYDDDDDDDDDDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQ
SLRLNA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggcgaatccaagaacatggtagtgaatggcaggagacatggcaacagg
ctgtcccatgagcaccatcggagtcgggccaagctgcacagattagggagaggaaattta
agaggcactaaaaatgtttctgatagaagatcaagcaggtgtagtggtgaagccacaaat
gtttttgaaactcagagccgctatgtaccttcatcagggatgaccgctaaagagctctgt
gaaaacgatgatcttgcaacaagtctggtgctggatccctacttagggtttcagactcac
aaaatgaatacaaggtttcgtccaataaaaggaaggcaagaagagctaaaggaagtgatt
gaacatttcaagaaaactgaacatttagagaaaaccttcaaaaatctaatatctggtgac
tggtcacgacactattttcttaataagaataaagcacaggagaaacatttcaaggaacat
gtgtttatctatttgaggatgtttgcaaccagcagcgggtttagctatatgcagaaacgt
aatgacaaaatagaacttctagtgggatgcatagctgagctttctgaagccgaagagaat
atgcttctacgtcatggagaaaatgactttagtgtcatgtactcaacaaggaaaaactgt
gctcagttatggctcgggccagctgccttcattaaccatgattgcagacctaattgcaag
tttgtatcgactgggcgtgacactgcgtgtgtcaaagctttgcgtgatattgagccaggg
gaagagatctcttgttattatggggatggtttttttggcgaaaacaatgagttctgtgaa
tgttacacctgtgaacggcgtgcaactggtgcttttaaatcacgcgttggtcttaatgaa
ccgagtcctgtgatcaacagcaagtatggattacgggaaacagacaaacgtttgaacaga
ctcaaaaagcttggtgacggcagcaaaaactcagacagtcagtctgtcagctccaacaca
gatgcagacacctctcaggaaaaatctagctcatgcagaaacagaaaatcttcagttggt
tcgaagaagaatgggaaaagtagaacgctgacaaaacagtctttgtcacaaatttcagtt
tcatcttctacctcatcaaaactctctcatataaataattccagggtaccaaagagacta
agaaagcctgtaaagcctttccattctaaagttaagatgagatatcactgcaagcgacca
gagcagagaaatacttcaaaaaatcttgaagtagggaatgtactacttaaggaacctaaa
gtagtgttgtataaaaatgtggccgttaaaagggataaagagagcgaaggaccagcaaag
ttgaaagaaagcactggttgtttaacaagacatgcagcaagagaatttaaactgaattct
ctgaaaggtgctcttggagaatcatcttgttcatatataactcgaagctctatgagaaca
aggaactctgtggaagcacctgatgctaagctttcaccaaattctttggatgttcataga
agcagcgatgggggtgttccaccattgcacagaactgactttcaagatcagtcattaaat
aacgatgaatttgatcataacacctcaaacagacaggagagtggataccagagaaacggt
ctgtgtaaatctagaaggaagtctagacggagcaaacacttgaaacaggctgctaacctc
gctgtgtcaaattgtgattttgaattgcctggcaaggataatactttgccaaacctagtg
agttcacattgtgagtcagatgctgtaaatgctttttctgatggtcatgttgattataaa
gatctgaggacatcttcagatggttgccctgtagtcagttcagaaataaggacaaaagaa
ataatcagaactgtcaaaagtaaaaaaagcagacgaatcacaagatatgatgcacaatta
attcttgaaaatagcactggaattccaaaactgactctccgtagacgccatgacagcaac
agcagcaaagcagaaaaggaaaatgatggcatgggctcatccaaaattagcattaaactg
agtaaagatcatgaaaaggacaagaacagtttgtatgtagcaaaacttaacaatggtttc
aactcaggatcaggtagtagttcaacaaaactaaagattcagctaaagagagaagaggaa
acgagaaggccttttccagaggaacttcatgaaaatggtgtgtattgtaaggatgcattg
tctctgctgggaaccagaatggaagttaacaactatgatcattatgaagaagagagtatg
ggggattcttcatcagaagaagagggagaagatgaatacgacgatgatgatgacgacgac
gatgatgatgatgattttgaggatgactttattcctctaccaccagcaaaacgtttgaga
ctgattgttggaaaagattcaatagacatcgatatatcctccaggcggagagaagatcag
tctttgcgattgaatgcgtga

DBGET integrated database retrieval system