KEGG   Nanorana parkeri: 108784343
Entry
108784343         CDS       T04897                                 

Gene name
KMT2C
Definition
(RefSeq) histone-lysine N-methyltransferase 2C
  KO
K09188  [histone H3]-lysine4 N-trimethyltransferase MLL3 [EC:2.1.1.354]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108784343 (KMT2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108784343 (KMT2C)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108784343 (KMT2C)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108784343 (KMT2C)
   HMT complexes
    MLL3/MLL4 complex
     108784343 (KMT2C)
SSDB
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Other DBs
NCBI-GeneID: 108784343
NCBI-ProteinID: XP_018408622
LinkDB
Position
Unknown
AA seq 5041 aa
MVVEPERRSCDKSLAHRPQNRGKAALEDEDSMDGLEAAEPENSADTDIKEKPVEEGAQTE
AADAEQLTPILQRSLSVESEHSTASVGVEAKSSEQLCAFCYCGERSLLGQGELKHFSPTP
DFILPWKTLTENKDPDGSDGTCKATGKTTKRGYRKVKSPLHNITYASVGTQTASEEQSSK
FWDELCQVGLTDDVHIQSLFEPTGHCWAHHRCAEWSPGVHQTADRELVNVDKAVVSGSTE
PCAYCKHLGATIKCCEETCSQMYHYPCAAGSGAFQDLTCFSLLCPEHIDQALERFKNEAN
CALCDSSGDLLDQLFCTTCGQHYHGMCLDIVVTPLKRAGWQCPDCKICQNCKHSGDDNKM
LVCDTCDKGYHTFCLQPVMDSVPTNGWKCKNCRICAECGTRTSRQWHLNCLICDSCFLQQ
ISIPCPLCDKPLQPELQKDMLHCQMCKRWIHLECEKCADYADEQFKDEYICPTCKQLEPE
DDAGEDCIEMEVAESDAICTDEIEVDTGGKITFQGEALNHNDIVPDAAAMCLDEETPEND
VKPDKESKPPSQVNTDSMDVSHSDTTYMLSNDGTVKAESEKNMSPQQPICLQEQENRPQP
QNSETSSEDRCKSQTFSRVLEDSCKSPCKVKLTDDAYAQLDEHFDLSRGHDHISTKKEDP
LISETMDVQDMEAIPKSEPFTEISSPLGLKILKSPTGMDSPATSVDTSKTSVSSSPAVSI
DFHSSNDLFQSQTPAHSFSTANAFSTTFVSVTPKIGMGKPAITKRKFSPGRPRSRQASWS
THNTVSPPSWSADGSEGWDTFKSRQLLGNPLWSIKVGRGSGFPRRRQRGSGLSGRGGRGR
SKLKPPIGNYIFPGLTTVDLSAYKEEEETSMHNTVVLFSTSDKFTLHQDMCVVCGSFGKG
AEGRLLACSQCGQCYHPYCVSIKISKVILRKGWRCLECTVCEACGKATDPGRLLLCDDCD
ISYHTYCLDPPLQTVPKGGWKCKWCVSCNNCKAITPGLRCEWQNNYTQCAPCASLATCPV
CGQNYIEDEIILQCRQCDRWSHGTCQNLNTDAEVESAADGGFDCAMCKPFAIPAQEIESP
VDAQIVLKIREPDVLKTFTQDGVCLTESGLSQLQSLTITAPRRRRSKPKLKLKIINQNSV
AVLQTPPDPQSEHSRDGEMDDSREGDLMDCDVKSDSSPEREPIDDDSKGAEVMDGIKKRK
RKPYRPGIGGFMVRQRSRTGQGKSKRSLSRKDSSGSVSELVPGRDDAWNEPLPDNPMDEC
APITENTEKVRKRYRKKKNKLEESFPTYLQEAFFGKNLLDTSRQNKQSIEHLSEDAAHLP
YKANINATFLDPSSDPLLSSAATPSRTTNGGSHDPLADLSEVLNTDDDIFGILSDDLAKS
SNQSGLDLCPFQVENSSSPFAGLDVGTMSDDSSSLPHASGPQSSRPLSEDQLDGILSPEL
DKMVTDGAILGKLYKIPELEGKEVEDLFTAVLSPVATHPPSLPQPPPPSAHPHPPHTQLL
PLQNQGDGLFPRMPMVNGLLPSNPHLPHNPLGPGHGLGPFSPLTQPPFPNRDKNAVYHGM
VNDPTNVWPAQAPVMEPEGDTMSSAQRSTQKWEKEEALGEMATVAPVLYTNVNFPHLKEE
FPDWSTRVKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSIKRQQHEIIDES
ARIDSDPFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQFGSH
HHLSQSGSDTPNSGNQSPLTPQPNSDNMSPNQQNFIKDPFTKQTLPGAPTSFSDDVFLKP
QAPPPTPTRIPLQDPIQLSQPHSPQMFSPGSSNSRPSSPFDPYAKMVGTPRPPPTSQNFH
RRNCGSPMDICPPRHIPGSESFDTRPSPIRDSCSSPSGTDPSLKMGDIQKNMGPADPFSK
PLGLSRLSHNTDQMIDGSLGPVNNDSFTKHSSRSEIYQRSQMPQKVDPYSRPPLTPTSGV
SPGSPAPFKTPLRPPQSPQESYNLLPTTPRRISSDPYERHVLTPRPAETFSHDLYNQAPH
GNRTMNEPFAHPPRLMRQHSDPQSASLSRSNAQDPYAQPPGTPRPTNNPYLKSPTASRST
AIDPYLQQPSTPRPPVQTMDPYNQPQSTPRPVMGDVFVQPSMNKRHHDSFAASPARNSMD
PYSQPPGTPRPAPSDPYALPPGTPRPVPSDPYAQPPGTPRPVPSDPYTQPPGTPRPVPSD
PYAQPPSTPRPVPSDPYSQPPATPRPVPLEVYAHPPGTPRPVPSDPYAQPPSTPRPVTSD
PYAQPPGTPRPLPLDPYSQPPATPRPAPSDPYAHQPATPRPAPSDLYSQPPATPRPMPLD
PYSQPPCTPQSVLADPYSQSPATPRPLPTDSYSQLNRTPRHVLSDLYAQPPRTPMPSGPE
SFNRSSVVRPVLIQNQESFLQNMQSRGAHFIRTSEGSSQNQRLAGQGSADLFNHSSSGLN
QEPYDHPPLAPHIQTGEGFGQSHDIGDQQRTFSEETFSGSSNIGASPQGQQFGNMPQMSG
LPDAQNSLLPMAESEEKARQRQKLREMILRQQQTKIAVRHEKMLDSLQIAQAAHPTQWQQ
DSPHRPHEVFNRPPPPYPGNIRASIGPKGNPQFSTFPKDQHTPFPGNAQFNRPPFTGDMS
VAIRPPPGHRYVYPMSGPGPVSGHERFMGPPLQMQVPGMPQQMRRDMSMELPRSLNGTQM
NNPAGLAPHFPSQAMPVQQHNISGQAYIELRHRPPDSRPRILLGPPSGMMDPSAQHQRHI
SYFPKPEFQGPRFMEQVRIQHPGLSNQVQVPPGYEHLIPTGQQPLMMHRVDQTQIGENYL
RTQLSDGTMGKESTILPPENSEPSGLEEKLDPDDPSEKDLDVKDLDGVEVKDLDDEDLEN
INLDPDDAKGDDLDGLDNLETNDPQLDDLLRSGKFDIIAYTDPELDLGDKKDMFNEDLDL
GVPIDDKLELQCKPEEEKSSEDSGKNSSPGPALSETITAVAIKTKPELDSPKDKALDVKS
EPTVASTTPEQPKEDGSSAPSTTSDQSEINEKDNVFKSEQSSEPLQLPALDAGSACGMPE
SVPMLTNLLTSESSEVDKLGSPGIMTVSQPDQVPVIPHSLITSPNQVIEPALNQNMGPIP
HPSFDQESPSNSVFMPGQQSGHNFVPGDPLNQGLPCPSGMQTAQQLMLQQSRERPLLLEE
QPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNVDFDAITDPIMKAKMVALKGINKV
MVNTMGMSPMAINRFPFMGQQMPGTQPMEPPNLAPPPITQDGSIATQMVRPNPPNFGPGF
VNDSQKKQYEEWLQETQQLLQIQQKLLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDA
EQLKHVTEQQSMVQKQLEQIRKQQKEHTELIEEYRNKQQQFSVAPLMPGVLPQQALMTGA
AAPPPPPPINPPNFQIPQTLHTPGPMIPGQPAQPRMPGWQPPHAPRNLAHPPRMQRPVGS
EVAGPAAPANPNAPPRVEFDDNNPFSETFQERERKERLREQQERQRIQLMQEVDRQRALQ
QRMEMEQQGINGQDLNSRSLSQMPFFASELPSDFMPVPQSPQQQAQMGHALSHQSTGNSP
PTVPFIQNSDKRSLGLSPYGQELQTGFPQASGHPSFMPNDTSASPVADSGRSSGQDRPVS
GTSFQSPSQSLIQLYSEIIPEEKGKKKRPRKKKKEEDADSLKSPPSTPRSDTTAPLTPSI
SEASTPTVNVPNDIGYQGEHVADLIRSSTPNTANNNSVELDDPLVTKDPQSAFEEPCVEE
ATSQAVSKDEHNNREIKLENTEGDKSPEQADPKVKNSSVELKTEEATSHDALLMETSSYT
ASAPSGKLESGNELLKHLLKNKKQPVILHRKSEESLQSYDCPVDVKSAAKPADALVSLRP
PENKELLSFNLNQNLLSRTDLNMDKKKPRNKRVQRSAEKAAPRSKKRKKEEEQKPSIFAS
SETFTHIKQQLSLLPLIEPIVGMNFAQFLPYGTGQISAGSRLLGTFGCASLDGVSDYYSQ
LIFKQNNLSNPPTPPASLPPTPPPVACQKMVNGYATTEELAGKAAILGGHVTKALGPKQF
HLPFRSQDDLLARAITQGPKSVDVPASLPTPPHNNQEELRVQDHCDGRDSPDSFVPSSSP
ESVVGMEISRYPDLSLVKEEPPDPAPSPIIPILPSSTGKGSEARDFGFKREPGTFFFGSH
FSHTPNGPKSDMISVAITLHPTAAENISGVVSAFADLLQVHIPTSYEVSSAPDSGSLILM
NGHSMHSNMEYRNPLLRHRPRPGNIPPARFIGPYAMKAHNLPYIPNNNGYRHNTTRVLGD
SATLRPSWCCHCKVVVLGSGVRKSVKNINFPKREFLPSAGQMDGELVFCSNNCFLLYSAA
QAKCSENKKQDRSLTLPLLKEPQPKSCHQYSNNTSTLDVHCLPLLQKASPPSSPPISFPP
AAFETAKVEAKPDELKVTVKLKPRPRAVHSGYDDSRPVSKKWKGMKWRKWNIQIVIPKMP
FKPQCEDDIDAFLKKLGTSLKPDPMPKDFRKCCFCHEEGDGMTDGSARLLNLDLDLWVHL
NCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKMGATSGCHRLRCTNIYHFTCAIK
AQCMFFKDKTMLCPMHKPKGAHEQELTYFAVFRRVYVLRDEVRQIASIVQRGERDHTFRV
GSLIFHAIGQLLPQQMLDFHSATALFPVGYEASRLYWSMRYANRRCRYHCSVEEKDGLPL
FVIKVNEQGHEDLVLTDSTPKGVWDKILEPVANCRKGSEILRLFPIYLKGEDLFGLTVSA
VARIAESLPGVEACEKYTFRYGRNPLMELPLAINPTGCARSEPKMNNHVKRFVLRPHTLN
STSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARD
IEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHVIDATLTGGPARYINHS
CAPNCVAEVVTFEKGHKIIISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWM
N
NT seq 15126 nt   +upstreamnt  +downstreamnt
atggtagtggagccggagcggaggtcatgtgataagagcctggcacacaggcctcagaat
agaggaaaagctgcattggaggatgaagatagtatggatggacttgaggcagcagaacca
gaaaactctgcagacacagacattaaagaaaaacctgtggaagagggcgcccagaccgaa
gcagcagacgctgagcagctaacacccattctccagcgctctttatccgtggagtctgag
cactccactgcctctgtgggagttgaagccaaaagcagtgaacaactttgtgcgttctgt
tactgtggtgaaagaagtctcttggggcaaggggaattaaagcatttcagtccaactccc
gactttatcctgccttggaaaacactgaccgagaataaagaccctgatggcagcgatggg
acttgcaaagccaccggaaagacaacaaaacgagggtatcgaaaagtaaaatctccacta
cacaatatcacatatgcaagcgtgggaacccaaacagcgtctgaagagcagagcagtaaa
ttttgggatgaactgtgtcaagttggcctgaccgatgatgttcatatccagtccttgttt
gagcccacaggtcactgttgggctcatcaccgttgtgccgagtggtcaccaggcgtgcac
caaactgcagatcgggagctggtcaatgtggacaaagcggttgtctcagggagcacagaa
ccatgtgcatactgtaagcaccttggagctacaatcaaatgctgtgaagagacatgttcg
cagatgtaccattacccctgcgctgctggatctggcgcctttcaggatctcacgtgcttt
tctctgctttgtccagagcacatcgatcaggctcttgagcgttttaagaatgaagctaac
tgtgcactgtgtgacagctctggagacctgctggatcagctcttttgtacaacttgtggt
cagcattaccatgggatgtgtctggacatagtggtgacccctttaaaacgtgctggctgg
cagtgcccggactgcaaaatctgtcaaaactgcaagcactctggagatgacaacaagatg
cttgtgtgtgatacctgtgataaaggttaccatactttttgcttgcagccagttatggac
tctgtaccaacaaatggttggaagtgtaagaactgccggatatgtgcagaatgtggtaca
cggaccagtcgtcagtggcacctgaactgtttgatatgtgacagttgtttcctgcagcaa
attagcataccttgcccactttgtgacaagcctctccagccagaactgcagaaagacatg
ctgcattgtcagatgtgcaaaaggtggatacatctagaatgtgaaaaatgtgcagattat
gcagatgagcagttcaaagatgagtacatctgtccaacgtgcaagcagctagagccggaa
gacgatgcaggggaagactgcattgagatggaggttgcagaatcagatgccatttgcaca
gatgagattgaagtggatacaggtggaaaaattacatttcaaggtgaagcacttaatcac
aatgatattgttccagatgcagccgctatgtgtcttgatgaagagacaccagagaatgac
gtcaaaccagacaaggaaagcaagccacccagtcaagtcaatacggacagtatggatgtg
tctcattccgacacgacatacatgctatccaatgatgggacagttaaggctgaatctgaa
aagaacatgtcacctcagcaaccgatatgtcttcaagagcaagaaaatcgccctcaacca
cagaactctgaaacttcatccgaggatagatgtaaatcacaaaccttttcacgtgttctt
gaggactcttgtaaatcgccttgcaaagtcaaactcacggatgatgcttatgcacagtta
gatgagcactttgacttgagcaggggccatgatcacatttcaacaaagaaagaggatcct
cttatttcagaaaccatggatgttcaagacatggaagccattccaaagagtgagccattt
acagaaattagctcacccttagggctcaaaattctgaagtctcctacaggaatggattcc
cctgccacctctgttgacactagtaagaccagtgtgtcatcctcaccagcagtatccatc
gactttcattcttcgaatgacctgtttcaaagtcaaactccggcacatagttttagcaca
gcaaatgccttttccaccacatttgtttccgtaactccaaaaattggcatgggtaagcca
gctattaccaaaaggaagttttctcctggccggccaagatccagacaggcctcttggagt
acccataatacagtgagcccaccttcctggtcagctgatggctcagaaggttgggacact
tttaaatccagacagcttctcggcaatccgttatggagcatcaaagtgggtcgaggctca
ggatttccgaggaggagacaaagaggttccgggctctccggccgtggcggaagaggccga
tcaaaattaaaaccgcctataggcaactatatatttccagggttaaccacagttgatctt
tcagcatacaaggaggaggaagaaacctcaatgcacaacacagttgtattattttccaca
agcgacaagttcaccttgcatcaggatatgtgcgtggtgtgcggtagttttggtaaaggt
gctgaaggaagactacttgcttgttcacagtgtgggcagtgctaccatccatactgtgtc
agtattaagattagtaaagtcatccttcgtaaaggctggaggtgtttggagtgcacagtg
tgtgaggcctgtgggaaggccacagatcctggccgactgctgctctgcgatgactgtgac
attagctatcatacatactgcctggatccgcccttacagactgttcccaaaggaggatgg
aagtgtaaatggtgtgtatcatgtaacaactgcaaagcaataacaccggggctgcgatgt
gaatggcagaacaactacacacagtgtgctccatgtgctagtttggctacttgcccagtg
tgtggccagaactacatagaagatgaaatcattctccagtgtcggcagtgcgacaggtgg
tcccatggcacctgccagaaccttaacacagacgctgaggtagagagcgcagcagacggt
ggatttgactgtgctatgtgtaagccgtttgcaataccagctcaagaaattgaatctcca
gtggatgcccagattgtcttaaaaattagagaacctgatgttctcaaaacctttacccag
gacggagtgtgcttgacagagtctggactttcacagttacagagcctaacaatcacagca
ccgaggcggaggcgatcaaaaccaaagttgaaattaaaaatcatcaaccagaacagtgta
gcagttctccagacacctcctgacccccagtctgagcattctcgtgatggagaaatggat
gatagtagagagggagatctaatggactgtgatgtgaaatctgactctagtcctgagcga
gaacctattgacgatgactctaagggtgcagaagtgatggatggaataaagaaaaggaaa
aggaagccatacagacctggtattggtggatttatggtgcgccaaagaagccgaacaggt
caagggaaatccaagagatctctttccagaaaagattcttctggctcagtttctgaactt
gtgccaggcagagatgatgcttggaatgaaccgctgcctgataatccaatggatgaatgc
gcccctatcactgagaacacagagaaagttaggaaacgataccggaaaaagaaaaacaaa
cttgaggaatccttcccaacgtatctgcaggaagctttttttgggaaaaaccttttggat
accagtcgacaaaacaagcagagcattgagcatttgtctgaggatgccgcccatctgccg
tacaaagcaaacattaatgctacctttttggatccatcatctgaccccctgctcagctcg
gctgcaacaccctcaagaaccacgaacggtggttctcacgatcctctagcagatctgtct
gaagttttgaacacagacgatgacattttcggtattctttctgatgatcttgcaaaatca
tcaaatcagtctggtcttgatttatgccctttccaggttgagaattcatcctctcctttt
gctggacttgacgtaggtacaatgtcagatgattcatcatcgctgcctcatgccagtggc
ccccaaagctctcggccattaagtgaagaccaactggatgggattctcagcccagaatta
gacaaaatggttacagatggtgcaattttgggaaagctgtataaaattccagaacttgaa
ggaaaagaggttgaagatttatttactgctgtgctgagtcctgtagccacccatccgcca
tctttgccacaaccgccaccaccttcagctcatccccatcctccacatacacagctcttg
cctttgcaaaaccagggtgatggtctttttccaagaatgcccatggtgaatggcttgttg
ccaagcaatcctcacttaccacacaatcctctcggcccaggacatggacttggtcctttc
tctcccttaacacaaccaccatttccaaacagggataagaacgcggtataccatggcatg
gtgaacgaccccacaaatgtttggccagctcaggctccggttatggagccagaaggagac
accatgtccagtgcccaaaggagtacacagaaatgggagaaggaagaagcccttggagaa
atggcgacggtggcccctgttttatacaccaatgttaatttcccacacctgaaggaggag
tttcctgattggtctacacgagtgaagcaaattgcaaaactctggagaaaagccagctcg
caagaaagagccccctatgtgcaaaaagccagggataaccgtgccgcactgcgaatcaac
aaagtgcaaatgtcaaatgactcgataaagcgacagcagcatgagatcattgacgaaagc
gcccggatcgattctgatccatttaaagatcccttgaagcagagagagtctgagcatgaa
caagagtggaagttcagacagcaaatgcgccagaaaagcaaacagcaggcgaagatagaa
gcaacccagaaacttgagcaagtaaaaaatgagcagcaacagcagcagtttgggtcccac
catcatttgagtcagtcaggaagtgataccccaaacagtggcaatcagagtcctttaaca
cctcaaccgaacagtgacaacatgtccccaaatcagcagaactttattaaagacccattt
actaaacagacattgcccggagcacctacatcattctcagatgatgtttttcttaaacca
caagctccacctccaactcccactagaatacctttacaggatcccatccagctttctcaa
ccacattcaccacagatgttttctcctggatcttccaactctagaccatcatctcccttt
gatccctatgctaaaatggtaggaacaccaagacctccacctaccagtcagaattttcac
agaaggaactgtgggtcacccatggatatttgtcctcctagacatatacctgggagtgag
tcctttgatactagaccatcccccataagagactcttgttcatctccttccggcactgat
ccctcattaaagatgggagatattcagaagaatatgggcccagctgatcctttttctaaa
ccattaggactgtcaagattgtctcataacactgatcagatgatagatggttctctgggt
ccagtaaacaatgattcttttacaaagcattcttccagatctgaaatatatcaaagatcg
caaatgccacaaaaagtggatccatattcaaggcctcccctcactcctacatcaggtgtt
tcacctggcagccctgcgccttttaaaactcctttgcgcccacctcagtcaccacaagag
tcttacaatttattacccacaacacctcgacgtatctcttcagacccatatgaaagacat
gttttgactccaagacctgctgaaactttttcacatgacctttataaccaagcacctcat
ggaaatcgtactatgaatgaaccatttgcacatccccctagactgatgcgacagcatagt
gatcctcagtccgcctctttgtctcgctcaaatgcccaggatccatatgctcagcctcca
ggaactccacgtccaacaaataacccatatttaaaatcaccaactgcttcaagatctaca
gcaatagacccttatcttcaacagccttctaccccaagaccacctgtgcaaacaatggat
ccttataatcagcctcaatcaactcctaggccagtaatgggagatgtatttgttcagcca
tctatgaataagaggcatcatgattcctttgcagcctcacctgcaaggaatagcatggac
ccatactctcagccacctggaacaccaagaccagcaccttcagatccctatgccctacca
cctggaacaccaaggcctgtgccttcagatccctatgcccaaccacctggaacaccaagg
cctgtgccttcagatccctatacccaaccacctggtacaccaaggcctgtgccttcagat
ccctatgcccaaccacctagtacaccaaggcctgttccttcagatccttattctcagcct
cctgcaaccccaaggccagttcccttagaagtgtatgctcatccacctgggactccgagg
cccgtaccttccgatccctatgctcagccaccttcaactccaaggccagttacttcagat
ccttacgctcagcctcctggaactccaaggccacttcctttagatccatactcgcaacca
cctgcaactccccggccagctccttcagatccatatgcacatcaaccagcaactcctagg
ccagccccttcagatctttactctcagccacctgcaacaccaagaccaatgcctttagac
ccttattctcaacctccttgtactccacaatcagtacttgcagacccttattcccagtcc
cctgctacaccaaggcctcttcccacagactcttactcgcaacttaatcgaactcctagg
catgtactttctgacctttatgctcagccaccaagaactccaatgcccagtggtccagaa
agctttaatcgttcctcagtggttcgcccagtgttgatacaaaaccaagagtcatttctg
cagaatatgcaaagcaggggagcccattttatcagaacatctgaaggaagctcccaaaat
caacgactagcaggccaaggttcagcagacctgtttaatcactcctcatctggccttaac
caggaaccttatgatcatcctccattggcacctcatatacagacgggtgaaggatttggc
caatcccatgatattggagatcagcaaagaactttttcagaggaaacatttagtgggtct
tctaatattggagcaagccctcaaggtcagcagtttggcaatatgccacaaatgtctggc
ttaccagatgctcagaattcattattacctatggcagaatctgaagagaaagcaagacag
cgtcaaaaactgagggagatgatactaagacagcagcaaaccaagattgctgttcgacat
gaaaagatgttggattcattgcaaattgctcaggctgcacaccccacccagtggcagcaa
gatagtccacatcggccacatgaggtcttcaacagacctccacctccttatcctggaaat
ataagagcctcaattggtcctaaaggaaacccacaattttctactttccccaaagatcaa
catactccattccctggcaatgcccagtttaacaggccgccattcactggagacatgagt
gttgctataagaccacctcctggtcacagatatgtctatcccatgtctgggcctggccct
gtctctggtcatgagcgctttatgggtcctcctctacaaatgcaagttccagggatgcct
cagcagatgagaagagatatgtcaatggagcttcctcggtctttaaacggcacacaaatg
aataatcctgctggtcttgctccacattttccttcacaggcaatgcctgttcagcagcat
aatatatcagggcaagcatacattgaactccgccataggcctccagatagcaggccacga
attcttttagggccaccttctggtatgatggacccatcagcacaacatcagagacatata
agttatttccctaagccagaatttcaaggcccaaggtttatggaacaagtacgaattcaa
catccaggtttatctaatcaagttcaagttcctccaggctatgaacacttgattcctact
gggcaacaaccacttatgatgcatagagtcgatcaaactcaaatcggtgagaattactta
cgaacacagctgtctgacggaaccatggggaaagaatcgacaattcttccacctgaaaat
tcggaacccagtggtttggaggaaaagctggatcctgatgatccttctgaaaaagatctt
gatgtgaaagatttagatggggttgaagtcaaagatttagatgatgaagatcttgaaaac
ataaacctagacccagatgatgcaaaaggagatgaccttgatgggctggataatctagaa
acaaatgatccccagcttgatgatcttttaagatctggaaaatttgatataattgcttac
actgatccagagcttgatcttggagataagaaagatatgtttaatgaggatctggatctc
ggtgtaccaattgatgataaattggaactccagtgcaagcctgaagaggaaaaaagtagt
gaagactctggtaaaaattcttctcctggacctgctttgtcagagactattacagctgtt
gccatcaaaacaaaaccggaattggattcaccaaaagacaaggcattggatgttaagtct
gaaccaacagtagcctctactacacctgagcaaccaaaggaagatggctcatctgcacca
tcaactactagtgaccagtcagaaataaatgaaaaggacaatgtgtttaaatcggaacaa
tcaagtgagccactgcagctgcctgctttagatgctggaagtgcttgtggcatgccagaa
tctgttccaatgcttaccaacttattaacgagtgagagttcagaggtggataaattaggc
tccccagggatcatgaccgtatcgcagcctgatcaagtgccagttatccctcacagttta
ataacttctcctaatcaagtgatagagccagctttaaatcaaaatatgggaccaatacct
catcctagctttgatcaggagtccccttcaaattcagtatttatgccgggccagcaaagt
ggccataattttgttccaggagacccattaaatcaagggttgccttgtccttctggtatg
caaactgctcaacaactgatgcttcaacagagtcgggagagacctcttcttctggaagaa
cagcctctcttattgcaggaccttcttgatcaagaaagacaagaacagcaacagcagagg
cagatgcaagctatgattcgccagcggtcagagccttttttccctaacgttgattttgat
gctattaccgatcctataatgaaagcaaaaatggtggctctaaaaggcatcaataaagtg
atggtgaatactatgggaatgtcaccaatggccataaacaggtttcccttcatgggacag
cagatgccagggacacaaccgatggaacctccgaaccttgctccacctcccatcacgcag
gatggaagcatagcaacacaaatggttagacccaaccctccaaatttcggtccaggattc
gtcaatgactctcagaaaaaacagtatgaagagtggctccaggaaacgcagcaactcctt
caaattcagcagaaacttctagaagaacagattggagctcacagaaaatctaaaaaggcc
ctttcagccaagcaaagaacagcaaagaaagctggtcgtgagtttccagaggaggatgct
gagcagctaaagcatgttactgagcagcagagcatggtgcaaaagcaactggaacagata
cgaaaacaacagaaagaacatacagaacttattgaggaatacagaaacaagcaacaacag
ttttcagtggcacctctaatgcctggtgttctaccacagcaagcactcatgactggagca
gcagcaccaccaccaccaccacctattaacccaccaaactttcaaattccacaaacacta
cacacaccaggaccaatgattccaggccagcctgcacagccaagaatgccaggttggcag
cctccccatgctcctagaaaccttgcacatccaccaaggatgcaacgtccagttggttct
gaagtagcaggccctgctgctcctgcaaatcccaatgctccaccgagggttgagttcgat
gataacaatcccttcagtgaaactttccaagagagggaacgcaaagaaagattgagagaa
cagcaagagcggcagaggatacaactcatgcaagaggtagatcgtcagcgagcattacag
caaaggatggagatggaacagcaaggcataaatggccaagacctgaatagcagatcattg
tcacagatgcctttcttcgcctctgaattaccaagcgactttatgccagttccacaatct
cctcagcagcaagcacaaatgggacatgcgttatcccaccaaagcacgggaaactctcct
cctactgtgccttttatacagaactcagataaaaggtccttggggctctctccttatgga
caagagcttcaaacaggctttccccaagcatctggtcatccctcatttatgccaaatgac
acatcagcatcacctgttgctgatagtggacgttccagtggacaagacaggccagtgagt
ggcacaagttttcaaagtcctagtcagtctcttatacagttgtactctgaaatcattcca
gaagaaaaaggaaagaaaaaaagacctcgaaagaagaaaaaagaggaagatgctgactca
ttaaagtctcctccctctacacctcggtctgatactacagctccactgactccaagtatc
tcagaggcgtcaacaccaaccgttaacgtccctaatgatattggttatcaaggagaacat
gtagctgacctaatacgttcatctacaccaaatacagcaaacaacaactctgttgaattg
gacgatcctcttgtcactaaagatccgcaaagtgcatttgaggaaccctgcgtggaggaa
gccactagtcaagcagtctcaaaagatgaacataacaatcgggaaataaaactggagaat
acagaaggagataagtctccagagcaagctgacccaaaagtgaaaaattcatcagtggag
ctaaagacagaagaagccacatcgcacgatgcacttttaatggaaaccagctcttacact
gcctccgcaccctcaggaaaactggaatctggcaatgaattactgaaacacttgctcaaa
aacaagaaacagcctgtcatcttgcatcggaagtctgaggaatctttacaatcatatgac
tgtcccgttgatgtaaagtctgctgcaaagccagcagatgcactggtgagtttgcggccc
ccagaaaataaggagctgttgagttttaatcttaatcagaacctgctctcaagaaccgat
cttaatatggataagaagaaaccaagaaataagagggttcagagaagtgctgaaaaggct
gcccctcgctccaagaaaagaaagaaagaggaggagcagaaaccctctatatttgcctct
tctgagacttttactcatataaaacagcaactctctctgcttcctctaattgagccaatt
gtgggaatgaactttgcacagtttcttccttatggcactggtcaaataagtgctgggagt
cgccttctggggacctttggctgtgcctcccttgatggagtttcggattattattcccag
ttgatttttaagcaaaataatctcagtaatccgcccacacctccagcctctttgccacct
actccaccaccagtggcctgtcaaaagatggtgaatggttatgccaccactgaagaactg
gcaggaaaagctgccattcttggaggacatgttaccaaagctctgggacccaaacagttc
cacctgcctttcaggtcccaggatgatcttttggctagagccattactcagggacctaaa
tcagtggatgtcccagcttcattaccgacaccaccacacaataatcaggaggagttgagg
gttcaggatcactgtgatggcagggacagccctgacagctttgtgccctcctcgtctcct
gagagtgtggttggaatggaaattagcaggtacccggatttgtcactagtgaaagaagaa
cctccagatccagcgccatcccccatcattccaatccttcccagcagcacaggaaaagga
tctgaagccagggactttggatttaagagagaacctggtacattcttttttggctcacac
tttagccatacaccaaatgggcctaaatctgacatgatatctgtggcaatcacactgcac
cctactgccgctgagaacatcagcggggtagtttcagcctttgcggatcttttacaagtc
cacattcccaccagctatgaagtgagcagcgctccagactctggttctctcatcctaatg
aatgggcacagtatgcactctaatatggagtatcgaaatccgctgttacgccaccgtccc
aggcctggcaacatacctccagccagatttatcggaccctatgccatgaaggcccacaac
ttgccatacataccaaataataatggatatagacacaataccaccagggtattgggagat
tctgcaacccttaggccatcatggtgctgccactgcaaagttgtggtcttaggaagcggt
gtccgaaaatctgtgaagaatatcaattttcctaaacgggagtttcttcccagcgctggc
cagatggatggtgagcttgtcttctgcagcaacaactgctttttgctgtattctgcagca
caagccaagtgcagtgagaacaagaagcaggaccgttccttaactcttccgttgttgaag
gaacctcaaccaaagtcttgtcatcagtacagtaacaacacttccaccctggatgttcat
tgccttcctttgctgcagaaggcctcaccaccttcatctcctcctatctcttttcctccg
gctgcttttgaaaccgctaaagttgaggcaaagccagatgaactgaaagtcactgtgaag
ttaaaaccgcggccccgagccgtgcacagtggttacgatgattcccgtcccgtcagcaag
aaatggaaaggaatgaagtggaggaaatggaatattcagatagttattcccaagatgcct
ttcaagcctcagtgtgaagatgatatagatgcatttttgaaaaagctggggacatcacta
aagccagatccgatgcccaaagattttagaaaatgttgtttctgccatgaagaaggcgat
ggaatgacagatggatccgcaaggcttctcaaccttgaccttgacctttgggtccactta
aactgtgctctttggtctactgaggtctatgagacacaggctggtgccttaattaatgtg
gagctggcattaagacgaggtctgcagatgaagtgtgtattttgtcataaaatgggagcc
accagcggttgccacaggttaaggtgcaccaatatttaccacttcacctgtgcaataaaa
gcacaatgcatgttttttaaagacaagactatgctttgccccatgcacaagccaaaggga
gctcatgagcaagaactgacttattttgcagtctttcgtagagtttacgttctgcgtgat
gaggtgcgacaaattgccagcattgtacagcgcggtgaacgtgaccacactttccgtgtc
ggcagtctgatcttccatgcaattggtcagctgctaccacagcaaatgctggatttccac
tctgcaacagcgctgtttccagtgggatatgaagccagcaggttgtactggagcatgcgc
tatgcaaacagacgctgccgctatcattgctctgtcgaagagaaagatggattaccattg
tttgtcatcaaagtgaatgaacagggccatgaagacctggttctgaccgattctacacca
aaaggagtttgggacaaaatcctggaacctgttgcaaactgcagaaagggttcagaaatt
ctcaggctgtttccaatttacctgaaaggagaagatctcttcggtttaactgtatctgca
gttgcaaggatcgcagaatcgctcccaggagttgaggcatgcgaaaaatacactttccgt
tatgggcggaacccattgatggagctccccctggccatcaatcccactgggtgtgcccgc
tccgaacccaagatgaataatcatgtcaagaggttcgtgttaaggcctcacaccttgaat
agcaccagcacttcaaagtcctttcagagcacagttacaggagaactgaatgctccatac
agcaagcagttcgtccattccaaatcctctcagtaccggaagatgaagactgaatggaag
tccaatgtctacctggctaggtctcggattcagggtctggggttatatgctgctagagat
attgaaaagcacactatggtgattgaatacattggaaccataatacgcaatgaagtagcc
aatagaaaagagaagctgtatgaatctcagaatcgtggtgtatatatgttccgcatcgac
aatgatcatgttattgatgccacattaactggaggacctgcaaggtatatcaaccattca
tgtgcgcctaactgtgtggctgaagtggtaacgtttgagaagggacataaaataattatc
agctccaatcgcaggatacaaaagggtgaagagctttgttatgactataagtttgatttt
gaagatgatcagcacaagatcccctgccactgtggtgccgtgaactgccggaaatggatg
aactga

DBGET integrated database retrieval system