KEGG   Nanorana parkeri: 108784873Help
Entry
108784873         CDS       T04897                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
npr  Nanorana parkeri
Pathway
npr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108784873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:npr01002]
    108784873
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108784873
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108784873
Peptidases [BR:npr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108784873
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108784873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108784873
NCBI-ProteinID: XP_018409310
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKCLLLLSFLGLAAAFSYNDDDKIVGGYTCPTNTVPYQVSLNSGYHFCGGSLINDEWVVS
AAHCYKSRIEVRLGEHNIEVLEGTEQFISSAKIIRHPNYNSYYLDNDIMLIKLSKPAVIS
SRVQAIRLPSQCDVAGTQCLISGWGNTLSNGSNYPDLLQCLNAPILSDEDCQGSYPGQIS
GNMICLGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGIGCALPGYPGVYTKVCNFVSWIE
DSIAQN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtcttctcctcctctcattccttggccttgctgccgccttctcctacaatgat
gatgacaagattgtagggggctacacctgccccaccaacaccgtcccataccaggtgtcc
ttaaattctggataccacttctgcggggggtccctcatcaatgacgagtgggtggtctct
gctgctcactgctataagtcacgtattgaggtcaggctcggtgaacataacattgaggtc
ctggagggaacagaacagttcatctcatctgctaagatcattcgtcatccaaattacaac
tcctattatctggacaatgacatcatgcttattaagctgtccaagcctgcggtaataagc
tccagggtccaggccatccgtctgcccagccagtgtgatgtggccggcactcagtgtttg
atctccggctggggaaacaccctaagcaatggatctaattacccagacctcctgcagtgt
cttaacgcccctatcctgtctgatgaggactgccaaggctcctatcctggtcaaatctct
ggaaacatgatctgcctggggttccttgaaggtggcaaagactcttgccagggtgactct
ggcggtcctgtggtttgcaacggggagctgcagggagtggtctcctggggtattggctgt
gctctgcctggctaccctggcgtctacaccaaggtgtgcaacttcgtgtcctggattgaa
gactccatcgcccaaaactaa

DBGET integrated database retrieval system